[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56592.1
DDBJ      :             putative peptide transporter
Swiss-Prot:             

Homologs  Archaea  53/68 : Bacteria  710/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:297 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  160->293 2r6gG1  f.58.1.1 * 1e-15 12.9 %
:HMM:PFM   117->292 PF00528 * BPD_transp_1 2.7e-27 28.4 169/185  
:BLT:SWISS 76->288 GSID_ERWCT 3e-29 30.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56592.1 GT:GENE BAD56592.1 GT:PRODUCT putative peptide transporter GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1899607..1900500) GB:FROM 1899607 GB:TO 1900500 GB:DIRECTION - GB:PRODUCT putative peptide transporter GB:PROTEIN_ID BAD56592.1 LENGTH 297 SQ:AASEQ MSDRRIVSGAGPAAALGAVAAWWRGARPAPQSVRANAGLVVSAAVTVLVLGWALFPSVFAGGDPLTGVPAEKLRPPSPDHWFGTDNVGRDLYTRVVHGAGLSLTATVSAVAIALVAGALLGLLAGALGGVVDAVTMRVVDVLLSIPALLLSLALVTALGFGTANVAIAVGVSLVANFARVMRSEVLRVRTATYVEAARASGVRWYVVLARHILPNAYRPVLALAAVEFGMAVLAVSALSFLGYGAKPPTPEWGSLISEGRNYLAGAWWLTTLPGLVIVAVVLAAQHLGRAVQRSRTA GT:EXON 1|1-297:0| BL:SWS:NREP 1 BL:SWS:REP 76->288|GSID_ERWCT|3e-29|30.0|213/301| TM:NTM 6 TM:REGION 6->28| TM:REGION 36->58| TM:REGION 103->125| TM:REGION 151->173| TM:REGION 224->246| TM:REGION 265->287| SEG 9->29|gagpaaalgavaawwrgarpa| SEG 37->50|aglvvsaavtvlvl| SEG 109->158|avaialvagallgllagalggvvdavtmrvvdvllsipalllslalvtal| HM:PFM:NREP 1 HM:PFM:REP 117->292|PF00528|2.7e-27|28.4|169/185|BPD_transp_1| RP:SCP:NREP 1 RP:SCP:REP 160->293|2r6gG1|1e-15|12.9|132/284|f.58.1.1| OP:NHOMO 2939 OP:NHOMOORG 767 OP:PATTERN 44313132333333322233321133344-4212---1-------2-41-B83-32331121113-11 1113A443344-2113311-12111A1111114333277919487B83345159432311552374666821111433223-41------------2--------11--1111111111111111111111111214556322159232233312221---1-3211532211--11111-11A5422441223666664554546445976653545324A42-111111E6144444434544445222211-2-22---------11-1--11--13332222----11-------11111111111111211---11111B25244433441321222111133-229-1-19963--182-2131163311----1111121GFL--46439-99A99898AAJ-33B3282BMJ--hPPUFFBQOHMMI3-1149CA6AA69B1111111111122-18----------------------------------1CEBAC57777544444557855552466C64A7113342343353B5BO241132222-------111211336122252233331111111211-----2111-1--------111-1111112-12--443111111131111111211111111121--132-1------65JA2656666665666-66666666666666666659A9B83255555555555545455967556463-544444443444---11-1-111111163634411322211311211111-2-1242222236572654429A91----1---246645555534566--1-------------11111111111111116---11----------------------233336B645211 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----2-------------1-------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 6-20| PSIPRED ccHHHHHHHcccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccHHccHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //