[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56595.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:251 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  155->248 1gm5A3  c.37.1.19 * 3e-04 30.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56595.1 GT:GENE BAD56595.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1903296..1904051 GB:FROM 1903296 GB:TO 1904051 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56595.1 LENGTH 251 SQ:AASEQ MRAVAGVPSAQLVPSRRSVVSLSRRLSTCCAAAIAAVALSSGVPAHAAPAAPAAVENPLLRGAAAPGDLLGAYQSAVEVLRGLGIDPFFYPTAAAFCGDGPLGLLPAAAGAVPGPWPKTGLNLPGLDLSAVKSGQTLFAFVPYGMGPDSGATAGLQVAWLNVSTGRAGMAAMGPLADVIGAMIPPEVPAQWRPIAEQALRNLFAAALPVGGIRAVPVDTGKGTVLAAVFGSVRNGDRDCFFLPTVGLTTVG GT:EXON 1|1-251:0| SEG 12->27|lvpsrrsvvslsrrls| SEG 31->38|aaaiaava| SEG 44->54|pahaapaapaa| SEG 100->115|gplgllpaaagavpgp| RP:SCP:NREP 1 RP:SCP:REP 155->248|1gm5A3|3e-04|30.8|91/259|c.37.1.19| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- -----------------11-1-----11111--1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED cccccccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHcHHHHcccccHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccEEEEEEEEcccccHHcccccEEEEEEEccccccEEEEcccccccccccccccccEEHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEEEEcccccEEEEccccHHccc //