[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56598.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:280 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   61->189 PF04240 * DUF422 1e-13 42.6 %
:HMM:PFM   44->251 PF04240 * DUF422 9.9e-29 30.2 199/215  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56598.1 GT:GENE BAD56598.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1906098..1906940) GB:FROM 1906098 GB:TO 1906940 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56598.1 LENGTH 280 SQ:AASEQ MSDRNRSAARARFLPLVLAVALVLAQIAYPLTAGPARDRVTVLVVLLAAGTALAHAAVTRGFRYAAGFLVIVSGLGLLSEVVGVALGVPYGCYEYAVDRIGPGLAGVPVLVPLAWTGGVYPVWIVAGLLTARSGRLRTPARIALTAIGAVGWDLFLDPQMVADGQWTWCDTDSGLPGVPEIPLTNYLGWLVVATVMAALLAVWEHAAPAPSQPRDEPATVVVPVAVFCWTWLGSALAHAAFLGLPASAGYGFLGMGVLGVPLLVLLVRDRRTATADRPRR GT:EXON 1|1-280:0| TM:NTM 7 TM:REGION 12->34| TM:REGION 39->61| TM:REGION 66->88| TM:REGION 107->129| TM:REGION 186->208| TM:REGION 221->243| TM:REGION 247->268| SEG 8->25|aararflplvlavalvla| SEG 40->59|vtvlvvllaagtalahaavt| SEG 190->202|lvvatvmaallav| SEG 251->279|gflgmgvlgvpllvllvrdrrtatadrpr| RP:PFM:NREP 1 RP:PFM:REP 61->189|PF04240|1e-13|42.6|122/207|DUF422| HM:PFM:NREP 1 HM:PFM:REP 44->251|PF04240|9.9e-29|30.2|199/215|DUF422| OP:NHOMO 18 OP:NHOMOORG 18 OP:PATTERN -----------------1----------------------------------------------1--- 1-----------------------------------1-11-1111---------------11--1-----------------------------------------------------------------------------------------------------1----------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1-------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10, 209-212, 273-280| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccEEccEEcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccccc //