[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56601.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:146 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   29->69 PF12300 * DUF3628 0.00018 41.5 41/180  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56601.1 GT:GENE BAD56601.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1909193..1909633 GB:FROM 1909193 GB:TO 1909633 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56601.1 LENGTH 146 SQ:AASEQ MSYASPSRYAAPGGPGKAGMLLEKADGLLMAAAGERDPRERFRTAYLAALRGAGAVLAHTGADAAPRARSRNAWVLLQRAAPEFVMWADYFSARSELRAALEAGLDRDVDDTEADEFASRVGAFLHDVEDLLRSAARLRPAPGMSA GT:EXON 1|1-146:0| SEG 45->58|aylaalrgagavla| HM:PFM:NREP 1 HM:PFM:REP 29->69|PF12300|0.00018|41.5|41/180|DUF3628| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 8-12, 63-72, 144-146| PSIPRED cccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //