[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56602.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:139 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->26 PF11239 * DUF3040 4e-07 84.6 %
:HMM:PFM   1->85 PF11239 * DUF3040 8.7e-32 54.3 81/82  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56602.1 GT:GENE BAD56602.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1909781..1910200 GB:FROM 1909781 GB:TO 1910200 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56602.1 LENGTH 139 SQ:AASEQ MPLSEHEQRMLEQIESALYAEDPKFASSVRGGRLRSTSSRRRLQAAALFVLGLFLLVAGIAGPKPGGFPIISLIGFIVMFGAGVLLLTGGSKGGAARGGHADLPTGPGASGGRGGGRPRKSGGFSERMEDRFRRRFEQE GT:EXON 1|1-139:0| TM:NTM 2 TM:REGION 45->67| TM:REGION 69->91| SEG 27->43|ssvrggrlrstssrrrl| SEG 45->62|aaalfvlglfllvagiag| SEG 89->101|ggskggaarggha| SEG 104->137|ptgpgasggrgggrprksggfsermedrfrrrfe| RP:PFM:NREP 1 RP:PFM:REP 1->26|PF11239|4e-07|84.6|26/82|DUF3040| HM:PFM:NREP 1 HM:PFM:REP 1->85|PF11239|8.7e-32|54.3|81/82|DUF3040| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------1---------------------1---------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 93-132, 136-139| PSIPRED ccccHHHHHHHHHHHHHHHcccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHccHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccc //