[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56603.1
DDBJ      :             hypothetical protein
Swiss-Prot:MRAZ_NOCFA   RecName: Full=Protein mraZ;

Homologs  Archaea  0/68 : Bacteria  354/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.129.1
:143 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->128 1n0fB PDBj 4e-15 31.2 %
:RPS:SCOP  1->137 1n0eA  b.129.1.2 * 5e-40 29.4 %
:HMM:SCOP  1->137 1n0eA_ b.129.1.2 * 1.4e-39 45.3 %
:RPS:PFM   1->48 PF02381 * MraZ 7e-10 60.9 %
:RPS:PFM   75->122 PF02381 * MraZ 9e-05 31.2 %
:HMM:PFM   1->70 PF02381 * MraZ 1.5e-23 31.4 70/72  
:HMM:PFM   73->136 PF02381 * MraZ 5.1e-23 39.1 64/72  
:BLT:SWISS 1->143 MRAZ_NOCFA 6e-69 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56603.1 GT:GENE BAD56603.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1910696..1911127 GB:FROM 1910696 GB:TO 1911127 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56603.1 LENGTH 143 SQ:AASEQ MFLGTYTPRLDDKGRLTLPAKFRDDLAGGLMVTKGQDHSLAVYPKEEFTALARRAAAASRSNPQARAFVRALAAGTDEQRPDAQGRITLSADHRRYANLSRDCVVIGSVDFLEIWDKQAWESYLAEHEEDYAQARDESLGGIF GT:EXON 1|1-143:0| SW:ID MRAZ_NOCFA SW:DE RecName: Full=Protein mraZ; SW:GN Name=mraZ; OrderedLocusNames=NFA_17570; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->143|MRAZ_NOCFA|6e-69|100.0|143/143| SEG 50->67|alarraaaasrsnpqara| BL:PDB:NREP 1 BL:PDB:REP 1->128|1n0fB|4e-15|31.2|128/139| RP:PFM:NREP 2 RP:PFM:REP 1->48|PF02381|7e-10|60.9|46/69|MraZ| RP:PFM:REP 75->122|PF02381|9e-05|31.2|48/69|MraZ| HM:PFM:NREP 2 HM:PFM:REP 1->70|PF02381|1.5e-23|31.4|70/72|MraZ| HM:PFM:REP 73->136|PF02381|5.1e-23|39.1|64/72|MraZ| RP:SCP:NREP 1 RP:SCP:REP 1->137|1n0eA|5e-40|29.4|136/141|b.129.1.2| HM:SCP:REP 1->137|1n0eA_|1.4e-39|45.3|137/0|b.129.1.2|1/1|AbrB/MazE/MraZ-like| OP:NHOMO 357 OP:NHOMOORG 354 OP:PATTERN -------------------------------------------------------------------- ---1111111111111111-11111111111111111111111111111111111111111111111---11111111----1----------------1--11-11-11--------------------------22211-1111-------------------------------------11111-1-1-1---------------111111------11--11111111111111111111111111111-111111111111111111111-----------------------------------------------1111111111111111-------1111111111111111111111111---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------1-11--11111111111-1-111-111-111111-------------1-11-------------------------111---111111-111111111111111111----11-1------11------111-11-11-1111111111111111111-1-11---11111111111111111111111-1--11111111111-------------11--1111----111-----------------11-1111-1-111------------------------------------------------------------11-----1-1-1--11---11-11----------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 89.5 SQ:SECSTR ccccEEEEcccTTcEEEcccHHHHHcccEEccccccccccEEccHHHHHHHHHHHHTcccccHHHHHHHHHHHTTcccEEccTTcEEEccHHHHHHTTccccEEEEEccccEEEEEHHHHHHHHHccc############### DISOP:02AL 57-59| PSIPRED cccccccccccccccEEccHHHHHHHcccEEEEEcccccEEEccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccEEEEEcccccEEccHHHHHHHccccEEEEEEcccEEEEccHHHHHHHHHHHHHHHHHHHHHHccccc //