[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56616.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  646/915 : Eukaryota  25/199 : Viruses  0/175   --->[See Alignment]
d.194.1
:244 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->238 1u05A PDBj 2e-33 41.1 %
:RPS:SCOP  17->239 1rv9A  d.194.1.2 * 8e-62 37.5 %
:HMM:SCOP  8->239 1xfjA_ d.194.1.2 * 5.7e-74 49.1 %
:RPS:PFM   18->237 PF02578 * Cu-oxidase_4 2e-35 49.3 %
:HMM:PFM   14->238 PF02578 * Cu-oxidase_4 7e-69 45.3 223/233  
:BLT:SWISS 17->242 Y2154_CORGL 1e-72 61.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56616.1 GT:GENE BAD56616.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1927771..1928505 GB:FROM 1927771 GB:TO 1928505 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56616.1 LENGTH 244 SQ:AASEQ MTVASTLTVRRVTTTRAGGFSAPPYDSFNLGDHVGDDPAAVRRNRVRLAEGIGLAPERLVWMEQIHGRNVEVVDGPRDEPVPATDALVTTVPDLALVVLSADCVPILLSDDEAGVIAAVHAGRIGARIGIVPRVLEVMIAQGARPERIGAFLGPAASGRHYEVPAAMRDDVEAHLPGSATTTVRGTPGLDLRAGIRRQLTEAGVGAVAVDPRCTIEDKTLFSHRRGAPTGRLAGVIWVDTRAGV GT:EXON 1|1-244:0| BL:SWS:NREP 1 BL:SWS:REP 17->242|Y2154_CORGL|1e-72|61.9|226/246| SEG 2->16|tvastltvrrvtttr| BL:PDB:NREP 1 BL:PDB:REP 18->238|1u05A|2e-33|41.1|214/243| RP:PFM:NREP 1 RP:PFM:REP 18->237|PF02578|2e-35|49.3|219/233|Cu-oxidase_4| HM:PFM:NREP 1 HM:PFM:REP 14->238|PF02578|7e-69|45.3|223/233|Cu-oxidase_4| RP:SCP:NREP 1 RP:SCP:REP 17->239|1rv9A|8e-62|37.5|216/242|d.194.1.2| HM:SCP:REP 8->239|1xfjA_|5.7e-74|49.1|232/256|d.194.1.2|1/1|CNF1/YfiH-like putative cysteine hydrolases| OP:NHOMO 688 OP:NHOMOORG 671 OP:PATTERN -------------------------------------------------------------------- -111111111111111111-11111111111111111111111111111---111111----1111111111111111111111----1111-1--1---------111--111-11-------111111111111--------11111111-111111111111111111-1-----1--1-11111--11111111111111111111111111111111111------111--------------1--11----------------------------------------------------------------------111------------1-11----1-1--1111111111111111111---1--111111111111111111111111111111111-11111111111-1111111111111111111111111111111111111111111------------1111111111111------1-1111111111111-11111111111111111111111111111111111111111111111111111111111111111111-1111-1111111111111111111111111111-1-------11-1111111111111111111111111111111111--111-1------11111111111111111-1111111111111111111111111111111111111111111211111111-222222222222---1111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111--11111111----------------------------------------1-------- --------------------------------------------------------------------------------------------------------------111-11---1-1--11-1-221-11--1-1--1-1-------11121------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 222 STR:RPRED 91.0 SQ:SECSTR #################cccccTTcccccccccccccHHHHHHHHHHHHHHHHTcccccccccccccccEEEcccccccccccccEEEEcccTcEEEEEEcccEEEEEEETTcccEEEEEEcHHHHHTTHHHHHHHHHTTccccGGGEEEEEcccccTTTcEEcHHHHHHHHTcGGGGGGEEEETTEEEcHHHHHHHHHHHHTccEEEEccccTTcTTTcccHHHHcccccEEEEEEEc##### DISOP:02AL 1-4, 243-244| PSIPRED ccccccccEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHccccccEEEEEEEcccEEEEEccccccccccccEEEEcccccEEEEEEcccEEEEEEcccccEEEEEEccHHHHHHHHHHHHHHHHHHccccHHHEEEEEccccccccccccHHHHHHHHHHcccccccccccccEEcHHHHHHHHHHHccccEEEEcccccccccccccEEEccccEEEEEEEEEcccccc //