[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56618.1
DDBJ      :             hypothetical protein
Swiss-Prot:SEPF_NOCFA   RecName: Full=Cell division protein sepF;

Homologs  Archaea  0/68 : Bacteria  112/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:308 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   220->292 PF04472 * DUF552 4e-14 39.7 %
:HMM:PFM   220->292 PF04472 * DUF552 2.3e-25 43.8 73/73  
:BLT:SWISS 29->308 SEPF_NOCFA e-153 100.0 %
:REPEAT 3|79->88|89->98|99->108
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56618.1 GT:GENE BAD56618.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1929344..1930270 GB:FROM 1929344 GB:TO 1930270 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56618.1 LENGTH 308 SQ:AASEQ MTHKIGTDEGLSKTSTPGRHRGRRKVDQMSTLHKFKAYFGMVPLEDYEDDYVDDRAPRASERGGARGPRPYSERAGYGADRYGEDRYSADRFGPERFGAERFGPDRFGADRFDEDADYPEPAYKSYKSGYPVARRDDYPEDAYGEDRYEAPRRPTRIDAAPSSGRFRAGGGAPMLRGATRGALAVDPEAEERRLEERMRPEPVVARRPGIFEDGGPLSKITTLRPRDYSEARIIGERFREGNPVIMDLVELSNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADVDVSAEERRRIAETGFYNQK GT:EXON 1|1-308:0| SW:ID SEPF_NOCFA SW:DE RecName: Full=Cell division protein sepF; SW:GN Name=sepF; OrderedLocusNames=NFA_17720; SW:KW Cell cycle; Cell division; Complete proteome; Cytoplasm; Septation. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 29->308|SEPF_NOCFA|e-153|100.0|280/280| GO:SWS:NREP 4 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000917|"GO:barrier septum formation"|Septation| NREPEAT 1 REPEAT 3|79->88|89->98|99->108| SEG 187->202|peaeerrleermrpep| RP:PFM:NREP 1 RP:PFM:REP 220->292|PF04472|4e-14|39.7|73/73|DUF552| HM:PFM:NREP 1 HM:PFM:REP 220->292|PF04472|2.3e-25|43.8|73/73|DUF552| GO:PFM:NREP 2 GO:PFM GO:0000917|"GO:barrier septum formation"|PF04472|IPR007561| GO:PFM GO:0005515|"GO:protein binding"|PF04472|IPR007561| OP:NHOMO 116 OP:NHOMOORG 112 OP:PATTERN -------------------------------------------------------------------- ---11-11111---11111-1111111111111111111111111111111111111111111111222211111111----1---------------------------------------------------------------------------------------------------------------111111111111111-1----111-11----------1---------------------1---11---------111--1----------------------------------------------------1-----------1---1----1------1-1111---1--11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-30, 60-61, 63-65, 122-217, 294-308| PSIPRED cccccccccccccccccccccccccccccccccccHHHHccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccEEEEEccccHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHccEEEEEcccEEEEccEEEEEEccccEEcHHHHHHHHHccccccc //