[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56619.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  57/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:101 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->93 PF02325 * YGGT 3.5e-16 35.1 74/75  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56619.1 GT:GENE BAD56619.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1930357..1930662 GB:FROM 1930357 GB:TO 1930662 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56619.1 LENGTH 101 SQ:AASEQ MVALFAVLYFVLFIFWLLLISRVIVEFIRSFARDWRPTGVVVVVLEVIFTITDPPVKLLRRLIPPVSLGGIRLDLSIMVLLFIVFILMSIVSRLGQPVAPV GT:EXON 1|1-101:0| TM:NTM 3 TM:REGION 6->28| TM:REGION 39->59| TM:REGION 71->93| SEG 40->44|vvvvv| HM:PFM:NREP 1 HM:PFM:REP 8->93|PF02325|3.5e-16|35.1|74/75|YGGT| OP:NHOMO 57 OP:NHOMOORG 57 OP:PATTERN -------------------------------------------------------------------- ----111-111--111111-11111111111111111111----11111111--11----111-11-1111-111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 100-101| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //