[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56621.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:64 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->48 PF07332 * DUF1469 1.8e-05 31.2 48/121  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56621.1 GT:GENE BAD56621.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1931637..1931831 GB:FROM 1931637 GB:TO 1931831 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56621.1 LENGTH 64 SQ:AASEQ MLVVTLVLAAIGFALLVTALTTGSVIWAWGCIVVCVIGAVLLLVSALRRPESESPPPPGRHARR GT:EXON 1|1-64:0| TM:NTM 2 TM:REGION 2->24| TM:REGION 26->47| SEG 48->58|rrpesespppp| HM:PFM:NREP 1 HM:PFM:REP 1->48|PF07332|1.8e-05|31.2|48/121|DUF1469| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 47-64| PSIPRED cHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccc //