[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56623.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  367/915 : Eukaryota  1/199 : Viruses  1/175   --->[See Alignment]
d.3.1
:202 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   106->181 2hbwA PDBj 6e-12 48.6 %
:RPS:SCOP  101->186 2evrA2  d.3.1.16 * 5e-21 36.0 %
:HMM:SCOP  79->202 2evrA2 d.3.1.16 * 4e-34 39.5 %
:RPS:PFM   103->186 PF00877 * NLPC_P60 2e-15 52.4 %
:HMM:PFM   103->184 PF00877 * NLPC_P60 6.3e-25 45.1 82/105  
:BLT:SWISS 116->202 Y2213_MYCBO 8e-17 44.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56623.1 GT:GENE BAD56623.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1935560..1936168 GB:FROM 1935560 GB:TO 1936168 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56623.1 LENGTH 202 SQ:AASEQ MPVSRIDGSTGGCVRMTRRIEYRKPLRRIAFGFVIATVASVLLAGAGWADTGSASGSAGSSGSGSGSGSGSGSGSGSSSGSAALPVPSIAGLGALAAATTQVGKPYEWGGVGPHTWDCSGLVQWAFRQVGVHLPRTTWQQAEVGAAVPLHALSPGDVVILHADASHVGIYAGFGQVLNAYGVGVPVGLTPLNQFVIHTIRRF GT:EXON 1|1-202:0| BL:SWS:NREP 1 BL:SWS:REP 116->202|Y2213_MYCBO|8e-17|44.8|87/385| TM:NTM 2 TM:REGION 29->47| TM:REGION 82->104| SEG 52->83|gsasgsagssgsgsgsgsgsgsgsgsssgsaa| SEG 90->100|aglgalaaatt| BL:PDB:NREP 1 BL:PDB:REP 106->181|2hbwA|6e-12|48.6|74/218| RP:PFM:NREP 1 RP:PFM:REP 103->186|PF00877|2e-15|52.4|84/100|NLPC_P60| HM:PFM:NREP 1 HM:PFM:REP 103->184|PF00877|6.3e-25|45.1|82/105|NLPC_P60| RP:SCP:NREP 1 RP:SCP:REP 101->186|2evrA2|5e-21|36.0|86/148|d.3.1.16| HM:SCP:REP 79->202|2evrA2|4e-34|39.5|124/0|d.3.1.16|1/1|Cysteine proteinases| OP:NHOMO 773 OP:NHOMOORG 369 OP:PATTERN -------------------------------------------------------------------- --12843433333334433-3F2234444443869A4456545C423-42111321-2112222533ABA61111111--31--2111------------------1--1---------------1----1-----11111---21-----1---------------111-------------111-----311--------1-1--11211113---33321--23332442--------------------2433223-111--112231----1111------------111-11-1--------1-----11---2-1-12-5633345642522B111211-2-22--3-164-11---121111--1-------------------------------------------------------------------------------------------------------------------------------1-1-1222222211112211111111221---1-----------1--1---1-----12222222---11---------22111112121-21-1------11------------1-------1---222-1----------------1------11---1-1---1------23221212222222122-222222222222222222222111-1-2222222222222222122222222-211111111111---1---------1--1--------------------------1-1111211-111111111------------------------111-1--111--------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- --------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 39.1 SQ:SECSTR ######################################################################################################TccccTTccccccccHHHHHHHHHHTTTccccccHHHHHHHcEEEcGGGccTTcEEEEcccEEEEEEEEETTEEEEEEc##################### DISOP:02AL 6-7, 48-90| PSIPRED cccccccccccHHEEEEcccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEcccccccccHHHHHHHHHHHcccccccccHHHHHHcccccHHHcccccEEEEcccccEEEEEEcccEEEEEccccccEEEEEccccccEEEEEc //