[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56626.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:185 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   31->101 PF01298 * Lipoprotein_5 3e-06 32.4 68/593  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56626.1 GT:GENE BAD56626.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1938670..1939227 GB:FROM 1938670 GB:TO 1939227 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56626.1 LENGTH 185 SQ:AASEQ MCWAASVTTRTYSNAKDEQLKLRTTGRIAIAGLAVVASLGLTACGGDDSGNDAKPTKTTTSAAATTTAANTPAVPTAAELNTQLQRALDPAVPNSEKLEMVQGIEADPELPSRLAQAYKDTGATVEVTDVTAFGDTLNAKAKIVLNGQENIADVPFVAEDGKWKVQKAWACTMLTNLGQQSVACA GT:EXON 1|1-185:0| SEG 53->78|akptktttsaaatttaantpavptaa| HM:PFM:NREP 1 HM:PFM:REP 31->101|PF01298|3e-06|32.4|68/593|Lipoprotein_5| OP:NHOMO 11 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -----11-1-11------------------------3111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 44-61| PSIPRED ccccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHEEEEEcccHHHHHHHHHHHHHcccccEEEEEcccccccccccEEEEEEccccccccccEEEEcccEEEEHHHHHHHHHHccccccccc //