[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56629.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  379/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:320 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  55->159 1s7bA_ f.39.1.1 * 1.5e-08 18.3 %
:HMM:SCOP  195->299 1s7bA_ f.39.1.1 * 2.4e-07 22.9 %
:HMM:PFM   41->152 PF00892 * EamA 1.7e-09 20.0 110/126  
:HMM:PFM   182->290 PF00892 * EamA 1e-07 23.4 107/126  
:BLT:SWISS 46->291 RARD_STREX 6e-42 44.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56629.1 GT:GENE BAD56629.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1943666..1944628) GB:FROM 1943666 GB:TO 1944628 GB:DIRECTION - GB:PRODUCT putative membrane protein GB:PROTEIN_ID BAD56629.1 LENGTH 320 SQ:AASEQ MSARVGTVGGVRTVTAVPGVVFGTSAYLAWGLFPAFFGLLAFTGAVEVLAQRILWTLVVVLVVLTLAGRLRELRGIDARTWRLAGLASAAISINWGVYVYGVTSGHVVECALGYFVNPLVTVAFGVLIFRERLAVAQWVALGLGALAVAVLTVDYGRPPVIALTLACSFALYGLVKKVIRLDALRGIAAEGLLSAPFALAYVIAGLLTGTSALLTGPAHAALLIATGPVTLVPLLLFAVAAQRVPLSTMGLLQYLTPALQMAWGVGVAHEPMPASRWAGFALIWLALAVFTADALVRGRRTRRAARSRAEDPEGVAGPAG GT:EXON 1|1-320:0| BL:SWS:NREP 1 BL:SWS:REP 46->291|RARD_STREX|6e-42|44.7|246/315| TM:NTM 10 TM:REGION 16->38| TM:REGION 47->69| TM:REGION 78->100| TM:REGION 106->128| TM:REGION 132->152| TM:REGION 158->175| TM:REGION 183->205| TM:REGION 221->243| TM:REGION 246->268| TM:REGION 275->297| SEG 3->21|arvgtvggvrtvtavpgvv| SEG 28->45|lawglfpaffgllaftga| SEG 54->66|lwtlvvvlvvltl| SEG 133->153|lavaqwvalglgalavavltv| SEG 204->218|aglltgtsalltgpa| SEG 292->309|adalvrgrrtrraarsra| HM:PFM:NREP 2 HM:PFM:REP 41->152|PF00892|1.7e-09|20.0|110/126|EamA| HM:PFM:REP 182->290|PF00892|1e-07|23.4|107/126|EamA| HM:SCP:REP 55->159|1s7bA_|1.5e-08|18.3|104/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 195->299|1s7bA_|2.4e-07|22.9|105/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 422 OP:NHOMOORG 379 OP:PATTERN -------------------------------------------------------------------- ----11111111111------1---1------11111111----11-1-11-111111--111-1--1111----------1------------------------------------------------------11111---1----------------------------------------------11111111111111111111111111111111211111111111111111111111111111--------------------11----111----------------------------------111---------------------11--------------11-1---1-----------11111------------------111111111-1-111111111111111111111111--211-111111112-------------1-1------------------------------1111------------1-------2--------11111----11-1-----1--111----11------------1--1-2-11--1111-1-1--1---1111-1---1211----------------------22111-111121111111311112121122-------------111111-1111111111-1111111111111111111111111122222222222222222111111111-111111111111---1-----------111---1-1----------------1221-11111112211111111----------122211111221221111111111-------1-----------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13, 299-313, 317-320| PSIPRED cccccEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccc //