[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56631.1
DDBJ      :             putative oxidoreductase
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  140/915 : Eukaryota  57/199 : Viruses  0/175   --->[See Alignment]
d.21.1
:272 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->266 1s7jA PDBj 3e-36 36.8 %
:RPS:PDB   6->270 3ednA PDBj 3e-22 14.7 %
:RPS:SCOP  1->270 1s7jA  d.21.1.2 * 2e-57 36.0 %
:HMM:SCOP  1->270 1s7jA_ d.21.1.2 * 4.1e-68 43.6 %
:RPS:PFM   8->251 PF02567 * PhzC-PhzF 7e-19 40.7 %
:HMM:PFM   8->252 PF02567 * PhzC-PhzF 2.6e-51 35.9 237/282  
:BLT:SWISS 1->270 Y2770_PSEAE 3e-40 37.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56631.1 GT:GENE BAD56631.1 GT:PRODUCT putative oxidoreductase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1947202..1948020 GB:FROM 1947202 GB:TO 1948020 GB:DIRECTION + GB:PRODUCT putative oxidoreductase GB:PROTEIN_ID BAD56631.1 LENGTH 272 SQ:AASEQ MEVLLHQIDAFADAPFSGNPAAVMPLLSWLPDELLQNLAEENNLAETAFYTSQLPPEAVAPPPDRPVFHLRWFTPRAEVDMCGHATLAAAAQILADIHPGEDRVSFFTRSGWLHVDRTDDDEYVLDLPAVTSVEIDPDPALVAALGVRPVRAYTGVDEVLVVESEREVRQVNPLFGSFPPLARAVIVTAPGEQADFVSRVFAPAVGIPEDPVTGSAHAQLVPLWAARLGGTNFVARQLSRRGGTLRCELVGDRVLLLGRCRRYLDGVVTLPE GT:EXON 1|1-272:0| BL:SWS:NREP 1 BL:SWS:REP 1->270|Y2770_PSEAE|3e-40|37.6|258/259| SEG 33->48|ellqnlaeennlaeta| SEG 55->67|ppeavapppdrpv| SEG 85->95|atlaaaaqila| SEG 156->171|vdevlvveserevrqv| BL:PDB:NREP 1 BL:PDB:REP 8->266|1s7jA|3e-36|36.8|247/260| RP:PDB:NREP 1 RP:PDB:REP 6->270|3ednA|3e-22|14.7|251/289| RP:PFM:NREP 1 RP:PFM:REP 8->251|PF02567|7e-19|40.7|231/274|PhzC-PhzF| HM:PFM:NREP 1 HM:PFM:REP 8->252|PF02567|2.6e-51|35.9|237/282|PhzC-PhzF| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02567|IPR003719| GO:PFM GO:0009058|"GO:biosynthetic process"|PF02567|IPR003719| RP:SCP:NREP 1 RP:SCP:REP 1->270|1s7jA|2e-57|36.0|258/260|d.21.1.2| HM:SCP:REP 1->270|1s7jA_|4.1e-68|43.6|257/260|d.21.1.2|1/1|Diaminopimelate epimerase-like| OP:NHOMO 238 OP:NHOMOORG 199 OP:PATTERN -------------------------------------------1------1----------------- --1-1-------------------------------1-11--------------------------11111----------1----------------------11111--------------------------------------------1111----11--1-111-------------------------------1--------1--------1------------1--------------------1------------------------1-1-----------------------------------------------111-111----111------1--------------1-----1--1--21111----------------------------------------1-------------1-111-----------------------111------------------------------1111--------------------------------------------1-------1-------------------------------------------1111-------------------------------11-1112--1-11---1------------1-------------11---1------------------------------1121----1----------------1---------1--------------2-----3222-12-1---------------1111111111--2222121-111111-------------1---11--122111--11-11----------2----11-------------------------------------1---------11 ------1-------1--------------------------------------------------------------------------------------------13132-1-3111-1--121-11341-22111--1111---11-1-1--112-11-1-21-------1----1----112211-31-111-11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 270 STR:RPRED 99.3 SQ:SECSTR HHHHcEEEEEcccEcTTcEEEEEEcccTTccHHHHHHHHHHHHcTTTccccHHHccccEEEEEccccccEEEEEccccEcccHHHHHHHHHHHHTTccccccEEEEEETTEEEEEEEEEcTTccEEEEEEEEEccccHHHHHHHTTcccEEEEcccEEEEEEcccHHHHHHcccGGGHHHHEEEEEcccccTTccEEcEEccTTccccEEcccHHHHHHHHHHTccccccEEEEEEEGGTccEEEEEEEcccEEEEEEcEEEEEEEEEEc## DISOP:02AL 272-273| PSIPRED ccEEEEEEEEEccccccccEEEEEEccccccHHHHHHHHHHccccEEEEEEEcccccccccccccccEEEEEEcccccccccccHHHHHHHHHHHHccccccEEEEEEccEEEEEEEEcccEEEEEccccccccccccHHHHHHcccccEEEEccccEEEEEccHHHHHHccccHHHHHHccEEEEEccccccccEEEEEEEEccccccccccHHHHHHHHHHHHHHccccEEEEEEEEccccEEEEEEEccEEEEEEEEEEEEEEEEEccc //