[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56635.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:314 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 97->254 LKHA4_CHAGB 9e-04 26.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56635.1 GT:GENE BAD56635.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1950486..1951430 GB:FROM 1950486 GB:TO 1951430 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56635.1 LENGTH 314 SQ:AASEQ MLSSPHLPRIARPGALLVALAVGLSAFGVGCAADDVEAPVSTDGTEPLGIGKEVTVPISVAAATLVSPGAEPRAVLRPTFAPGTEQQVTLRTDHRIQQQINDQPSRDFSAPALTIPMTAHTSADGVDLTLGEVTTPDPLLSKALTAADGSHAGFDFSDDGAITALRLAPGPDTPNAARAALENAFYQAVYRSIMFPDEPVGEGAVWRVHQEVTGGVTLDQVTTATLTRREGDRLTIELAVTQTPKSTSWTLPNDAGTLDIEDYVMEGNGTITVDLGLPLPVAGSITVGGHQSYRDPRSVSLLRQSITTQVSWAE GT:EXON 1|1-314:0| BL:SWS:NREP 1 BL:SWS:REP 97->254|LKHA4_CHAGB|9e-04|26.8|157/100| TM:NTM 2 TM:REGION 11->33| TM:REGION 51->73| SEG 14->30|gallvalavglsafgvg| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- -----1-1111111----------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 34-46| PSIPRED ccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHccccccccEEEEEcccccccEEEEEcccccccEEEEEEEEcccEEcccccccccccccEEEEEEEEccccccEEEEEcccccccHHHHHHHHHcccEEEEEEEcccccEEEEEEcccccccHHHHHHHHHHHHHHHcccEEccccccccccEEEEEEEEEccEEEEEEEEEEEEEEEccEEEEEEEEEccccccEEEEcccccEEEEEEEEEccccEEEEEccccccccEEEEEEEEEEEcccccEEEEEEEcccEEEEcc //