[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56637.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  141/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:155 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   29->152 1cjxA PDBj 9e-13 10.5 %
:RPS:SCOP  29->133 1xy7A  d.32.1.9 * 3e-19 27.1 %
:HMM:SCOP  12->148 1u69A_ d.32.1.7 * 1.1e-31 39.2 %
:RPS:PFM   29->132 PF06983 * 3-dmu-9_3-mt 2e-05 34.0 %
:HMM:PFM   20->131 PF00903 * Glyoxalase 3.1e-10 22.2 108/128  
:BLT:SWISS 12->149 Y911_MYCBO 3e-24 37.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56637.1 GT:GENE BAD56637.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1952239..1952706 GB:FROM 1952239 GB:TO 1952706 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56637.1 LENGTH 155 SQ:AASEQ MSDVKPVPDGYPAVSPGLAIDGAAAAIDFYKQVLGATERMRMPRPDGKIAHCELLVGESVIMLGDPAPDMGFFDPKAVGGTPVNLHVYVRDVDEAFRQAMEAGAKEIAPVGNQFYGDRTGSFEDPWGHRWTVATHVEDVPPDEMDRRMAELFGES GT:EXON 1|1-155:0| BL:SWS:NREP 1 BL:SWS:REP 12->149|Y911_MYCBO|3e-24|37.7|138/170| SEG 17->28|glaidgaaaaid| RP:PDB:NREP 1 RP:PDB:REP 29->152|1cjxA|9e-13|10.5|124/352| RP:PFM:NREP 1 RP:PFM:REP 29->132|PF06983|2e-05|34.0|97/126|3-dmu-9_3-mt| HM:PFM:NREP 1 HM:PFM:REP 20->131|PF00903|3.1e-10|22.2|108/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 29->133|1xy7A|3e-19|27.1|96/120|d.32.1.9| HM:SCP:REP 12->148|1u69A_|1.1e-31|39.2|120/0|d.32.1.7|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 220 OP:NHOMOORG 144 OP:PATTERN --------------------------------------------1----------------------- 123--------1--11111-12--121111113333311--1---3-1----2-------------1----------------------------------1---112-----------------------------11-----1-1--1----------------111----------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------2112-----13---1-1--1-----------------------11-1---11122112-1-11----1---1---------------2-------------------------------------11-1323323133313322333312432-1-1--112--------11-111---------------1-1----------------1-1-1-2--232313--------------------------------------1--1111-----------------------------------------------------------------------------------------------------------------111111----1-1---------------------------------111--1111---------------------------------------------------------------------------------------------------1- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3-----1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 81.3 SQ:SECSTR ############################HHHHHHccEEEEEEEEEccccEEEEEEEEcTTcccTTcccHHHHHHHHHTcccccEEEEEEccHHHHHHHHHHTTccccccccHHHHHTHHHHcTTccccHHHHHHHTcEEEEEEETTEEEEEEEc# DISOP:02AL 1-2, 154-155| PSIPRED ccccccccccccEEEEEEEEccHHHHHHHHHHHcccEEEEEcccccccEEEEEEEEccEEEEEEcccccccccccccccccEEEEEEEEccHHHHHHHHHHcccEEEEcccccccccEEEEEEcccccEEEEEEEcccccHHHHHHHHHHHHccc //