[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56640.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  39/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:118 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   25->111 PF04341 * DUF485 1e-14 44.8 %
:HMM:PFM   23->112 PF04341 * DUF485 4.9e-38 53.3 90/91  
:BLT:SWISS 19->115 YWCB_BACSU 1e-06 26.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56640.1 GT:GENE BAD56640.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1956469..1956825) GB:FROM 1956469 GB:TO 1956825 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56640.1 LENGTH 118 SQ:AASEQ MTSTDLDGTAPQRTPSAEEFAQVQASPQFQELRNRLRRFVFPMTAVFLLWYVGYVLLGAYAHDFMATKVFGNINVGLLLGLGQFLTTFAITAAYVRFANRELDPRAAAIREQLEGVRA GT:EXON 1|1-118:0| BL:SWS:NREP 1 BL:SWS:REP 19->115|YWCB_BACSU|1e-06|26.3|95/102| TM:NTM 2 TM:REGION 39->61| TM:REGION 73->95| SEG 76->82|glllglg| RP:PFM:NREP 1 RP:PFM:REP 25->111|PF04341|1e-14|44.8|87/89|DUF485| HM:PFM:NREP 1 HM:PFM:REP 23->112|PF04341|4.9e-38|53.3|90/91|DUF485| OP:NHOMO 45 OP:NHOMOORG 39 OP:PATTERN -------------------------------------------------------------------- --1--112111--1-------1---1------11111111----111--11-111111--111-2142111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-22, 117-118| PSIPRED ccccccccccccccccHHHHHHHHHcHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccc //