[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56642.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:110 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   31->99 PF04341 * DUF485 4.5e-07 27.9 68/91  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56642.1 GT:GENE BAD56642.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1958709..1959041) GB:FROM 1958709 GB:TO 1959041 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56642.1 LENGTH 110 SQ:AASEQ MVLAQRRGARRVLTRGEVVEQTEIGEALINGLIRAQLGLAVRMALVTVLVLGSLPLLFTVAELGTAHVFGIRLPWLLLGVAVYPALFLIGRLYVALAERNEADFLDVTRD GT:EXON 1|1-110:0| TM:NTM 2 TM:REGION 33->55| TM:REGION 72->94| HM:PFM:NREP 1 HM:PFM:REP 31->99|PF04341|4.5e-07|27.9|68/91|DUF485| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ---------------------1---1-------1111111-----1-------1------11--1----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED cccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcc //