[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56645.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:153 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   59->105 PF01345 * DUF11 0.00091 25.6 43/76  
:HMM:PFM   108->137 PF04240 * DUF422 0.00062 30.0 30/215  
:BLT:SWISS 44->130 YX012_HUMAN 6e-04 31.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56645.1 GT:GENE BAD56645.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1961184..1961645) GB:FROM 1961184 GB:TO 1961645 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56645.1 LENGTH 153 SQ:AASEQ MRSSMSSAHPVRTAAVAGSALTALLVATAPVAHAGPGGAFAPLYSLTQGPCVAMVASSVNGNAYPDQAAFTVNTTMLGVGSCELTVTLHWRNVQTGQTGEFAVTAHGPGYWSNSGPGAIFGPGVGSFTGWVSVNAPSVGASGEIQFDVPQYQG GT:EXON 1|1-153:0| BL:SWS:NREP 1 BL:SWS:REP 44->130|YX012_HUMAN|6e-04|31.5|73/100| TM:NTM 2 TM:REGION 11->33| TM:REGION 39->61| SEG 13->34|taavagsaltallvatapvaha| HM:PFM:NREP 2 HM:PFM:REP 59->105|PF01345|0.00091|25.6|43/76|DUF11| HM:PFM:REP 108->137|PF04240|0.00062|30.0|30/215|DUF422| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12, 152-153| PSIPRED ccccccccccEEHHHHHHHHHHHHHHHHccccccccccccHHHHHcccccEEEEEEEccccccccccEEEEEEEEEEEcccEEEEEEEEEEcccccccccEEEEEcccccccccccccEEcccccccEEEEEEcccccccccEEEEEcccccc //