[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56649.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.23.2
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   66->108 1qyaB PDBj 6e-04 50.0 %
:RPS:SCOP  38->126 1nqdA  b.23.2.1 * 3e-08 15.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56649.1 GT:GENE BAD56649.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1967557..1967946 GB:FROM 1967557 GB:TO 1967946 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56649.1 LENGTH 129 SQ:AASEQ MTTLPRPLRTAFTAVAAALIGLAGAGAAHAGVYTQLHFPPGTSSTGVGGAIVRGEVDTYIIEARAGQLFSAAVGSVEDNATYSLIAPDGTFLVLDALYDEVVLPEDGNYVLDIAPTRGNTEYWLQVSIV GT:EXON 1|1-129:0| SEG 14->32|avaaaliglagagaahagv| BL:PDB:NREP 1 BL:PDB:REP 66->108|1qyaB|6e-04|50.0|38/307| RP:SCP:NREP 1 RP:SCP:REP 38->126|1nqdA|3e-08|15.7|89/111|b.23.2.1| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 38 STR:RPRED 29.5 SQ:SECSTR #################################################################EcEEEGGGTEEEEcccHHHHHHHHHHHH#####HTTccccccc##################### DISOP:02AL 1-2| PSIPRED cccccHHHHHHHHHHHHHHHHHcccccccccEEEEEEEcccccccccccEEEEccccEEEEEEccccEEHHHHcccccccEEEEEcccccEEEEEEcccEEEccccccEEEEEEccccccEEEEEEEEc //