[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56650.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  92/915 : Eukaryota  33/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:220 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   107->168 1xxlA PDBj 6e-06 35.5 %
:RPS:PDB   39->197 3bzbB PDBj 1e-11 13.2 %
:RPS:SCOP  51->203 2avnA1  c.66.1.41 * 7e-15 25.4 %
:HMM:SCOP  50->217 1zx0A1 c.66.1.16 * 9.5e-27 31.0 %
:RPS:PFM   104->189 PF01209 * Ubie_methyltran 6e-10 37.2 %
:HMM:PFM   55->149 PF08241 * Methyltransf_11 4.6e-17 33.3 93/95  
:HMM:PFM   130->184 PF08448 * PAS_4 0.00022 31.5 54/110  
:BLT:SWISS 53->183 MET7B_RAT 8e-12 33.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56650.1 GT:GENE BAD56650.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1967980..1968642) GB:FROM 1967980 GB:TO 1968642 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56650.1 LENGTH 220 SQ:AASEQ MRRGLAGVAATCQSGPMGWYGDHVVPRMVNCACGMRVNEPYRARVCAGLRGRVVEIGFGSGLNVPFYPDTVASVTAVEPADLGWRLAAQRVARARVPIERAGLDGSALPFPDNSFDSALSTWTMCTIPDVAGALAELRRVLVPGGTLHFVEHGLAPDPAVRVWQHRLNPVQKTIAGGCHLDRDIAALVRDSGLRIQELETCYGEGPKFLTALTLGVAAAP GT:EXON 1|1-220:0| BL:SWS:NREP 1 BL:SWS:REP 53->183|MET7B_RAT|8e-12|33.1|130/244| SEG 85->96|rlaaqrvararv| BL:PDB:NREP 1 BL:PDB:REP 107->168|1xxlA|6e-06|35.5|62/231| RP:PDB:NREP 1 RP:PDB:REP 39->197|3bzbB|1e-11|13.2|159/198| RP:PFM:NREP 1 RP:PFM:REP 104->189|PF01209|6e-10|37.2|86/234|Ubie_methyltran| HM:PFM:NREP 2 HM:PFM:REP 55->149|PF08241|4.6e-17|33.3|93/95|Methyltransf_11| HM:PFM:REP 130->184|PF08448|0.00022|31.5|54/110|PAS_4| GO:PFM:NREP 1 GO:PFM GO:0008168|"GO:methyltransferase activity"|PF01209|IPR004033| RP:SCP:NREP 1 RP:SCP:REP 51->203|2avnA1|7e-15|25.4|138/246|c.66.1.41| HM:SCP:REP 50->217|1zx0A1|9.5e-27|31.0|158/0|c.66.1.16|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 193 OP:NHOMOORG 135 OP:PATTERN -----------------------11----1--------------------111--1-1-21------- ----1---------122--------1------1-1-3111-1-2-1--------1-------3--12111------------1--1----------------------1------------------------------------12-11---11--------1--1111----------------11----------------------------------------------------------------------------------------------------------------------------------------11-------------------------1----1--------1---1------1111-------111----------------------1--2---11-------2----1---11------------------------1-------------------------------11-1----------------------------1-----------1-1-------------------------------1-1-------------------22221----------------------------------1-----1------------1---------1111--------------------------------------------------------------------------------------------------111-11------------------------------1111----1---------------------------------------------------------------------------------------------1-----1--1-- --------21----1---------------------------------------------------------------------------------------------3-1--11----1-----------------------1-----------11------1-2-------2-1--2S211311112-2231-12-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 184 STR:RPRED 83.6 SQ:SECSTR ##################################ccGGHHHHHHHHHcGGcEEEETTcTTcHHHHHHccEEEEEEcccHHHHHHHHTcccccEEEEccTTcccHHHHHHHccccccEEEEEcccccGGGHHHHHHHHHHcccTTTcTTcEEEEEEEcccccccTGGGHHHHHHHHcccEEEEEEEEEccEEEEEEEEEEcccccEEEEEcccEEEcHH## DISOP:02AL 1-3| PSIPRED ccccccHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHcccccEEEEEccHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHccccEEEEEccHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccEEEEEEcccccHHHHHHHHHHccEEcc //