[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56654.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  43/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.45.1
:144 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  33->129 2asfA1  b.45.1.1 * 4e-04 16.7 %
:RPS:PFM   22->138 PF04075 * DUF385 1e-26 54.7 %
:HMM:PFM   14->143 PF04075 * DUF385 5.2e-55 47.7 130/132  
:BLT:SWISS 1->143 Y1584_MYCBO 6e-66 75.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56654.1 GT:GENE BAD56654.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1973156..1973590) GB:FROM 1973156 GB:TO 1973590 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56654.1 LENGTH 144 SQ:AASEQ MPLTGEYEPSPSDWARKQVETYENSGGTEGTTLQGKPVVVLTTKGAKTGKLRKTPLMRVEHNGEYAVVASLGGAPKHPVWYHNIKAEPHVELRDGTEVGDYTAREVTGEEKRVWWERAVEVWPDYAEYQTKTTREIPVFVLTPR GT:EXON 1|1-144:0| BL:SWS:NREP 1 BL:SWS:REP 1->143|Y1584_MYCBO|6e-66|75.5|143/148| RP:PFM:NREP 1 RP:PFM:REP 22->138|PF04075|1e-26|54.7|117/130|DUF385| HM:PFM:NREP 1 HM:PFM:REP 14->143|PF04075|5.2e-55|47.7|130/132|DUF385| RP:SCP:NREP 1 RP:SCP:REP 33->129|2asfA1|4e-04|16.7|90/125|b.45.1.1| OP:NHOMO 176 OP:NHOMOORG 43 OP:PATTERN -------------------------------------------------------------------- ----3---------B6744-46--5944444378886485-21723--------------322-214222------------------------------------------------------------------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccccccccccHHHHHHHHHHHcccEEEEEEccccEEEEEEccccccccEEEEEEEEEEcccEEEEEccccccccccEEEEEccccEEEEEEccEEEEEEEEEcccHHHHHHHHHHHHHcccHHHHHHccccEEEEEEEccc //