[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56657.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  42/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:118 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->112 3dxoB PDBj 2e-11 35.9 %
:RPS:PDB   3->112 3dxoB PDBj 4e-09 38.2 %
:RPS:SCOP  4->112 3dxoA1  d.17.4.19 * 5e-30 37.6 %
:HMM:SCOP  1->118 1s5aA_ d.17.4.10 * 3.8e-12 36.8 %
:HMM:PFM   4->116 PF07366 * SnoaL 9.2e-08 20.2 109/126  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56657.1 GT:GENE BAD56657.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1976736..1977092 GB:FROM 1976736 GB:TO 1977092 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56657.1 LENGTH 118 SQ:AASEQ MNELVAQYLEIWNTTDAAARRAAIARVFTDEPRYVDPLMAVTGRDALDAGIAAVQAQFPDLVFRLAGPVDGHHDQVRFTWELGPADGPALVVGFDVAVLEQGRIADVYGFLDKVPAAA GT:EXON 1|1-118:0| SEG 17->26|aaarraaiar| BL:PDB:NREP 1 BL:PDB:REP 8->112|3dxoB|2e-11|35.9|103/115| RP:PDB:NREP 1 RP:PDB:REP 3->112|3dxoB|4e-09|38.2|102/115| HM:PFM:NREP 1 HM:PFM:REP 4->116|PF07366|9.2e-08|20.2|109/126|SnoaL| RP:SCP:NREP 1 RP:SCP:REP 4->112|3dxoA1|5e-30|37.6|109/117|d.17.4.19| HM:SCP:REP 1->118|1s5aA_|3.8e-12|36.8|114/0|d.17.4.10|1/1|NTF2-like| OP:NHOMO 44 OP:NHOMOORG 42 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------11----12----------------11----121--------------------------------1---1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----------------------------1--111----1-11------------------------------------------------------------------------111111-----1111------1-11111--11--------1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 117 STR:RPRED 99.2 SQ:SECSTR #HHHHHHHHcccHHHHHHHHHHEEEEHEEEEEEEEcccEEHHHHHHHHHTHHHHHHHcTTcEEEEEEEEEEETTEEEEEEEEEcTTccEEEEEEEEEEcTTccEEEEEEEEEHHHHHH DISOP:02AL 118-119| PSIPRED cHHHHHHHHHHHccccHHHHHHHHHHHHcccccEEccccccccHHHHHHHHHHHHHHccccEEEEcccccccccEEEEEEEEEccccccEEEccEEEEEEcccEEEEEEEEEcccccc //