[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56659.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  64/915 : Eukaryota  77/199 : Viruses  0/175   --->[See Alignment]
:407 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   15->287 PF09994 * DUF2235 1e-41 45.6 %
:HMM:PFM   13->287 PF09994 * DUF2235 8.7e-74 42.9 252/276  
:BLT:SWISS 13->242,258->294 YEC3_YEAST 2e-16 31.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56659.1 GT:GENE BAD56659.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1977652..1978875 GB:FROM 1977652 GB:TO 1978875 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56659.1 LENGTH 407 SQ:AASEQ MPHPVRRETTTMKRLVVCCDGTWKAENSSTVSNIVKIAQTVRMEAPGPDGSPIRQQVIYVSGPGARGFTADRLIGGAFGLGLEANLSAAYWQLAVNWEPGDEIFVFGFSRGAYTARSLVGLIDRIGIMRPDSMIGGHYPTALAMYRRLGGSRLSNWGPPPTEDDWAAFRAEHSRMVPVDFLGVFDTVGALGVPGITSWRHSFHNVNLSERVLCARQALAVDERRRNFEPCLWTVPVALNIKYRRIKHRAGRERVKQVWFRGVHSDIGGGYEECGLSDATFRWMVAEAEAEGLAFDRALVECLAGRCVNRPEHDKLHDSLGLGYRILNVVRAARSVRARHGRFYWNSWRKLHVEGDHGVRLASTAAADRDDLPTNLRRWLDELGGSCPETLVEPVPPAAAGQRPRAVA GT:EXON 1|1-407:0| BL:SWS:NREP 1 BL:SWS:REP 13->242,258->294|YEC3_YEAST|2e-16|31.9|247/682| SEG 328->338|vvraarsvrar| RP:PFM:NREP 1 RP:PFM:REP 15->287|PF09994|1e-41|45.6|250/265|DUF2235| HM:PFM:NREP 1 HM:PFM:REP 13->287|PF09994|8.7e-74|42.9|252/276|DUF2235| OP:NHOMO 298 OP:NHOMOORG 141 OP:PATTERN -------------------------------------------------------------------- --------------1---------------------1------------------------------1--------------------------------------------------------------------------------2-112----------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------121231-----2------------21--311-1-1----11------------1111111221-------------------------------------------------------------------------------------------1---12-----2-----------------------1-1--1------1---------------------------------------------------1--111111-1111-1--1-----------------1-----------------------------------------------------------------------------------------------1-----------------------------1111------------------------------------------------------------------------------------------------------------1- ---------------6653323275672222-22222222222222221253474413122211-111--11-1-111111-11-----64A654G----411111-------------------------------------------------------------------------------4---4--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 305-316| PSIPRED cccccccccccccEEEEEEEcccccccccccHHHHHHHHHHHHHccccccccEEEEEEEcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHcccccEEEEEEEEEcHHHHcccccccccccccccccccccEEEEEEEEcccccccccccEEcccccccccccccccccccccEEEEEEcccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccEEEccccHHHHHHHHHHccccccHHHHHHHHHcccccccHHHHHHHHHHccccHHHcccccccccccccccccc //