[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56662.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.82.1
:177 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->105 1y3tA PDBj 1e-04 25.5 %
:RPS:PDB   3->137 1cauB PDBj 3e-08 11.7 %
:RPS:SCOP  12->97 1y3tA1  b.82.1.5 * 1e-08 22.4 %
:HMM:SCOP  9->153 1juhA_ b.82.1.5 * 6e-11 24.5 %
:HMM:PFM   37->92 PF07883 * Cupin_2 1.5e-12 33.9 56/71  
:BLT:SWISS 5->105 QDOI_BACSU 3e-04 25.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56662.1 GT:GENE BAD56662.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1983588..1984121) GB:FROM 1983588 GB:TO 1984121 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56662.1 LENGTH 177 SQ:AASEQ MSEQRAVTFRNGHRVTLVDRGVDERGPYLKLHHHLPQPGRQAGPHWHPELAESWTVRAGRLWFEVDGTEIVAGPGVTVSAPPRAVHQFRCEEPGTEFDHEIRPPLRHWQMFELWSALDLAGRTTAGRIPRNPLALALLWEYQDGYLAGVPAWAQRFVLGGLARIARRVGYPRPPAEV GT:EXON 1|1-177:0| BL:SWS:NREP 1 BL:SWS:REP 5->105|QDOI_BACSU|3e-04|25.5|98/100| BL:PDB:NREP 1 BL:PDB:REP 5->105|1y3tA|1e-04|25.5|98/330| RP:PDB:NREP 1 RP:PDB:REP 3->137|1cauB|3e-08|11.7|128/184| HM:PFM:NREP 1 HM:PFM:REP 37->92|PF07883|1.5e-12|33.9|56/71|Cupin_2| RP:SCP:NREP 1 RP:SCP:REP 12->97|1y3tA1|1e-08|22.4|85/330|b.82.1.5| HM:SCP:REP 9->153|1juhA_|6e-11|24.5|143/0|b.82.1.5|1/1|RmlC-like cupins| OP:NHOMO 6 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1---------------------------------------------2-------------------------------------------------------------1-----------------------------------------------------------------1--------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 165 STR:RPRED 93.2 SQ:SECSTR ##cccccEEETTEEEEEEcTTTcHHHHTcEEEEEEEcTTEEEEEEEEcccEEEEEEEEccETcccEEEEEEEcTTcEEEEcTTccEEEEEcccEEEEEEEETcTTccEEEccEETTcccccccccGGccHHHHHHHcHHHHHHHHHTcccccHHHHHHHHHHHHHHH########## DISOP:02AL 1-4, 38-40, 174-177| PSIPRED cccccccccccccEEEEEEcccccccEEEEEEEEEcccccccccccccccccEEEEEEEEEEEEEccEEEEEccccEEEEcccccEEcccccccEEEEEEEccccccHHHHHHccccccccccccccccccHHHHHHHHHHccccccccHHHEEEHHHHHHHHHHHHHccccccccc //