[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56668.1
DDBJ      :             putative transporter subunit
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  129/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.92.2
:342 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   59->308 2r79A PDBj 3e-12 30.6 %
:RPS:PDB   27->324 3eiwA PDBj 6e-38 14.5 %
:RPS:SCOP  56->322 1efdN  c.92.2.1 * 2e-34 20.7 %
:HMM:SCOP  44->322 1n2zA_ c.92.2.2 * 7.6e-41 31.4 %
:RPS:PFM   58->296 PF01497 * Peripla_BP_2 3e-14 38.6 %
:HMM:PFM   55->301 PF01497 * Peripla_BP_2 4.6e-29 26.7 225/238  
:HMM:PFM   1->23 PF08085 * Entericidin 0.00023 34.8 23/42  
:BLT:SWISS 87->322 BTUF_SALCH 8e-08 31.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56668.1 GT:GENE BAD56668.1 GT:PRODUCT putative transporter subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1994173..1995201) GB:FROM 1994173 GB:TO 1995201 GB:DIRECTION - GB:PRODUCT putative transporter subunit GB:PROTEIN_ID BAD56668.1 LENGTH 342 SQ:AASEQ MNRPVRILAAAALAATLAACGTAHPTASDLVLTNCGAETSFPAPAHRLFVNDSNMVSMLLALGAQDQVIAVSSLQRDADTLRKHYGPAAVDGLSDVAPHSPSRETVLAQRPDVMVAGWNYGYTEAANLTPDSLRKDGIAAYILTESCRQRAGERARGVVEPWTALRTDLTNLGAITGRTERAADLVADLDTRLAALHAAPQAPRKPAVFLFDSGSDTIFSSGKFGAPQAILDSAGARNILDDVADTWTKVSWERLASADPDAIMFVDYPGQTFEQKVELLRGKPGINELRAVREGRFLNLPYVLWTSGPLNIDAAEQIRARLEQWELLPPSGIRPRADDEVR GT:EXON 1|1-342:0| BL:SWS:NREP 1 BL:SWS:REP 87->322|BTUF_SALCH|8e-08|31.1|193/266| SEG 8->19|laaaalaatlaa| BL:PDB:NREP 1 BL:PDB:REP 59->308|2r79A|3e-12|30.6|222/279| RP:PDB:NREP 1 RP:PDB:REP 27->324|3eiwA|6e-38|14.5|275/292| RP:PFM:NREP 1 RP:PFM:REP 58->296|PF01497|3e-14|38.6|202/235|Peripla_BP_2| HM:PFM:NREP 2 HM:PFM:REP 55->301|PF01497|4.6e-29|26.7|225/238|Peripla_BP_2| HM:PFM:REP 1->23|PF08085|0.00023|34.8|23/42|Entericidin| GO:PFM:NREP 2 GO:PFM GO:0005381|"GO:iron ion transmembrane transporter activity"|PF01497|IPR002491| GO:PFM GO:0006827|"GO:high-affinity iron ion transport"|PF01497|IPR002491| RP:SCP:NREP 1 RP:SCP:REP 56->322|1efdN|2e-34|20.7|242/262|c.92.2.1| HM:SCP:REP 44->322|1n2zA_|7.6e-41|31.4|239/0|c.92.2.2|1/1|"Helical backbone" metal receptor| OP:NHOMO 178 OP:NHOMOORG 132 OP:PATTERN ------------------------1--------------------1---------------------- ------11----221------1---3----------1413--1-111-112----------1-3522123--------------------------------------------------------------------------2----------------------2-----------------------------------------------------1---------1----------------1-------------------------------------------------------------------------------1111111111---------1---2--------------11---1-1------------------------11111111111-------1--1--111111122211-----1131-1111----------------1-----------------------------------------1111-1-111----1111111-------------1--1-1----------1--------------------------------------------------------------------------------------------------------------------41-1-1--------1----------------------11211-------------------2--------------------------------------1---------------------------2222221212121-222---------------------1--------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 303 STR:RPRED 88.6 SQ:SECSTR #####################EEEEcccEEEEEETTEEEEEETTcccEEEccHHHHHHHHHTTccccEEccTTcGGGccHcTTHHHHHHHcccEEcccccccHHHHHHTcccEEEEETTTTTTHHTHGTHHHHHHHccEEEEccTTccccHHHHHHHccTcHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHccccTTccEEEEEEETTEEEEccTTcHHHHHHHHTTccccccHHHHHEEEEcHHHHHHHcccEEEEEEGGGccccHHHHHHHHcHHHHTcHHHHTTcEEEEEHHHHTTTcHcHHHHHHHHHHHHH################## DISOP:02AL 334-342| PSIPRED ccHHHHHHHHHHHHHHHHcccccccccccEEEEEcccEEEEcccccEEEEEccHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHccccccccccccHHHHHHccccEEEEEccccccHHHHHHHHHHHHccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccEEEEEccccHHHHHHHHHcccccHHHcccccccccHHHHHHHcccEEEEEccccccHHHHHHHHHHccHHHcccHHHcccEEEEccHHHccccHHHHHHHHHHHHHHHHccccccccccccHHccc //