[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56677.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  69/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:194 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->191 2vprA PDBj 6e-19 29.6 %
:RPS:PDB   5->185 3b6aA PDBj 1e-14 29.3 %
:RPS:SCOP  5->66 3c07A1  a.4.1.9 * 2e-10 30.6 %
:RPS:SCOP  65->191 1a6iA2  a.121.1.1 * 8e-16 23.1 %
:HMM:SCOP  1->69 1zk8A1 a.4.1.9 * 1.6e-12 27.5 %
:HMM:SCOP  69->193 2g7gA2 a.121.1.1 * 1.3e-24 32.3 %
:HMM:PFM   65->187 PF02909 * TetR_C 1.1e-17 31.7 123/139  
:HMM:PFM   9->54 PF00440 * TetR_N 7.3e-17 41.3 46/47  
:BLT:SWISS 7->184 TETR5_ECOLX 7e-20 34.5 %
:PROS 20->51|PS01081|HTH_TETR_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56677.1 GT:GENE BAD56677.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2003846..2004430) GB:FROM 2003846 GB:TO 2004430 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD56677.1 LENGTH 194 SQ:AASEQ MQLHRADVVDGAIAILDQYGLADLTMRRLASSLQVQPGALYWHFPNKQALLGAVADRILAPMEAPVTATDWAGQLTELAHRLRDCLLAYRDGAELVSATYASRLTTSKGRERLAGVAIRAGMPRQEAELAAYTLLYYVLGQTVDEQSRMQMDSAGALPADDTPLDETPDATARFDFGLQLFIAGVRHLLGSRVR GT:EXON 1|1-194:0| BL:SWS:NREP 1 BL:SWS:REP 7->184|TETR5_ECOLX|7e-20|34.5|177/211| PROS 20->51|PS01081|HTH_TETR_1|PDOC00830| BL:PDB:NREP 1 BL:PDB:REP 2->191|2vprA|6e-19|29.6|189/197| RP:PDB:NREP 1 RP:PDB:REP 5->185|3b6aA|1e-14|29.3|181/213| HM:PFM:NREP 2 HM:PFM:REP 65->187|PF02909|1.1e-17|31.7|123/139|TetR_C| HM:PFM:REP 9->54|PF00440|7.3e-17|41.3|46/47|TetR_N| RP:SCP:NREP 2 RP:SCP:REP 5->66|3c07A1|2e-10|30.6|62/75|a.4.1.9| RP:SCP:REP 65->191|1a6iA2|8e-16|23.1|121/127|a.121.1.1| HM:SCP:REP 1->69|1zk8A1|1.6e-12|27.5|69/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 69->193|2g7gA2|1.3e-24|32.3|124/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 96 OP:NHOMOORG 69 OP:PATTERN -------------------------------------------------------------------- ----1111111-1-5-1----1---2------12223343--12-1---111---11---1-21--114-2-----------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1---1------------1-----------------------------------------------------------------------------------------------------------------------------------------1----------1---11-------1------------------------------------------------------------------------111-21--------1------1--------------------------------------------------------------------------------------------------------1-------------------------------------------------------1------11----1----1----11-----2-----1-----1---1-------1--------------------------------2------------1-1---2-----------------------------------------1------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 193 STR:RPRED 99.5 SQ:SECSTR #cccTTHHHHHHHHHHHHHcGGGccHHHHHHHTTccHHHHHHHHccHHHHHHHHHHHHGGGcccccccTcHHHHHHHHHHHHHHHHHHcTTHHHHHHTcccccHHHHHHHHHHHHHHHTTTccHHHHHHHHHHHHHHHHHHHHHHHTcTccTTTcHHHHHTHHHHHcccHHHHHHHHHHHHHHHHHHHHTTTTc DISOP:02AL 193-194| PSIPRED ccccHHHHHHHHHHHHHHcccccccHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcc //