[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56679.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:75 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->22 PF08793 * 2C_adapt 0.00012 43.8 16/37  
:HMM:PFM   41->63 PF01396 * zf-C4_Topoisom 0.00091 26.1 23/39  
:BLT:SWISS 11->72 Y1616_MYCBO 2e-21 69.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56679.1 GT:GENE BAD56679.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2005589..2005816 GB:FROM 2005589 GB:TO 2005816 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56679.1 LENGTH 75 SQ:AASEQ MSSVVDMDERYNPFTGQRIVPGLDDAVPAAAALGLEPPRFCEQCGRRMIVQVSPDGWWAKCSRHGVIDSKSLEHR GT:EXON 1|1-75:0| BL:SWS:NREP 1 BL:SWS:REP 11->72|Y1616_MYCBO|2e-21|69.0|58/79| HM:PFM:NREP 2 HM:PFM:REP 7->22|PF08793|0.00012|43.8|16/37|2C_adapt| HM:PFM:REP 41->63|PF01396|0.00091|26.1|23/39|zf-C4_Topoisom| OP:NHOMO 32 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- -----11111111111111-11111111-1-1111111-1-------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 69-70, 73-75| PSIPRED cccccccccccccccccEEcccccccccHHHHHcccccHHHHHcccEEEEEEcccccEEcccccccEEHHccccc //