[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56681.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:177 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   35->103 PF07087 * DUF1353 9e-09 39.1 %
:HMM:PFM   18->105 PF07087 * DUF1353 4.9e-28 44.3 88/95  
:BLT:SWISS 32->69 Y4JT_RHISN 3e-04 44.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56681.1 GT:GENE BAD56681.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2006474..2007007 GB:FROM 2006474 GB:TO 2007007 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56681.1 LENGTH 177 SQ:AASEQ MPFVGSGSTVEEIDGTFWRLAQPLVYRGASQEFTVPAGFRTDFASVPRALVWLIPRYGAYTRAAILHDYLRAGAVVSAADADGIFRRSLREFGVSVPRRWMMWAAARVGSGLAGASAGDLLRFLLVAVPAVLFLAIPVLVVSLALWVFWVVELLFWSGARLTRRTEGPAPRPEMKTA GT:EXON 1|1-177:0| BL:SWS:NREP 1 BL:SWS:REP 32->69|Y4JT_RHISN|3e-04|44.7|38/336| TM:NTM 1 TM:REGION 129->151| SEG 72->83|agavvsaadadg| SEG 104->118|aaarvgsglagasag| SEG 120->141|llrfllvavpavlflaipvlvv| RP:PFM:NREP 1 RP:PFM:REP 35->103|PF07087|9e-09|39.1|69/93|DUF1353| HM:PFM:NREP 1 HM:PFM:REP 18->105|PF07087|4.9e-28|44.3|88/95|DUF1353| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 165-177| PSIPRED ccccccccEEEEccccEEEEEccEEEEccccEEEccccEEEcccHHcHHHHHccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEcccccccccccccc //