[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56682.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  151/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.113.1
:221 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->173 2fb1C PDBj 1e-14 35.6 %
:RPS:PDB   2->134 2b0vA PDBj 2e-12 16.4 %
:RPS:SCOP  20->137 2fb1A2  d.113.1.6 * 2e-13 35.0 %
:RPS:SCOP  140->214 2fb1A1  a.4.5.68 * 2e-11 23.3 %
:HMM:SCOP  17->138 2fb1A2 d.113.1.6 * 5.9e-27 41.3 %
:HMM:SCOP  139->216 2fb1A1 a.4.5.68 * 2e-14 35.5 %
:RPS:PFM   20->124 PF00293 * NUDIX 2e-05 33.0 %
:HMM:PFM   19->120 PF00293 * NUDIX 1.8e-15 25.7 101/135  
:BLT:SWISS 20->123 NUD18_HUMAN 3e-05 30.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56682.1 GT:GENE BAD56682.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2007050..2007715) GB:FROM 2007050 GB:TO 2007715 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56682.1 LENGTH 221 SQ:AASEQ MPASGVLRPCPPDQRTELAVLLWERALDPQKGTWSLPGGRLRDDEDLDTSARRQLAEKVDVRELAHLEQLSVFSDPHRVPGPRRIASAYLGLVPLTAEPELPDDTAWHPVSALPTMSFDHGIVVEHARTRLAAKLSYTNIAFALAPATFTMSVLREIYCAALGYDVDTTNLQRVLHRRKVITPTGATAAPGRAGGRPAAVHRFTDSGLRVTDEFAALRPPT GT:EXON 1|1-221:0| BL:SWS:NREP 1 BL:SWS:REP 20->123|NUD18_HUMAN|3e-05|30.6|98/323| SEG 182->199|tptgataapgraggrpaa| BL:PDB:NREP 1 BL:PDB:REP 17->173|2fb1C|1e-14|35.6|149/217| RP:PDB:NREP 1 RP:PDB:REP 2->134|2b0vA|2e-12|16.4|128/146| RP:PFM:NREP 1 RP:PFM:REP 20->124|PF00293|2e-05|33.0|103/132|NUDIX| HM:PFM:NREP 1 HM:PFM:REP 19->120|PF00293|1.8e-15|25.7|101/135|NUDIX| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00293|IPR000086| RP:SCP:NREP 2 RP:SCP:REP 20->137|2fb1A2|2e-13|35.0|117/147|d.113.1.6| RP:SCP:REP 140->214|2fb1A1|2e-11|23.3|73/76|a.4.5.68| HM:SCP:REP 17->138|2fb1A2|5.9e-27|41.3|121/0|d.113.1.6|1/1|Nudix| HM:SCP:REP 139->216|2fb1A1|2e-14|35.5|76/0|a.4.5.68|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 186 OP:NHOMOORG 153 OP:PATTERN -------------------------------------------------------------------- ----1-11111---11111-11111111111111112112-313212-----222111--11--11121211111111------------21-1-----2-4131414-2--------------------------11111---1-2112111-1--------111-1111------------111---------------------------------------------11------------------------11-1-1-111111-1---------------------------------------------------------------------------------------------------------------------1--------------------11-12-11-------112---1------------------------------------------------------------------------------------------------------------1--11--1--------1---------------1--------------------------11------------------------------11--1--1-------------------------1---------1------------------------------------------1-----------------------------------------------------1-----------------1111111----111111-------1---------------------------------------------------------------------------------------------------11 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------22--------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 172 STR:RPRED 77.8 SQ:SECSTR #cEEEEEEEcEETTEcEEEEEEEEEcccccccEEEccEEEccTTccHHHHHHHHHHHHHcEcEEEEEEEEEEEEEEETTTTEEEEEEEEEEEETTccccTTEEEEEEEEHHHHHHTGGcccTHHHHHHHHHTTcccccGGGGccccccccccccHHHHHHTTcccccHHHHHH################################################ DISOP:02AL 1-2, 190-194| PSIPRED cccccEEccccccccccEEEEEEEEccccccccEEcccccccccccHHHHHHHHHHHHHcccccccEEEEEEEcccccccccEEEEEEEEEEcccccccccccccccccHHHcccccccHHHHHHHHHHHHHHHHcccccHHHHccccccHHHHHHHHHHHHcccccHHHHHHHHHccccEEEcccEEccccccccccEEEEEcHHHHccccccccccccc //