[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56687.1
DDBJ      :             putative chloramphenicol resistance transporter
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  123/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:391 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->390 1pw4A_ f.38.1.1 * 2.9e-49 30.8 %
:RPS:PFM   7->71 PF07690 * MFS_1 3e-04 38.5 %
:HMM:PFM   8->260 PF07690 * MFS_1 3.6e-31 29.0 248/353  
:HMM:PFM   217->376 PF07690 * MFS_1 2e-09 28.5 158/353  
:BLT:SWISS 1->330 CMLR_STRLI 2e-43 55.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56687.1 GT:GENE BAD56687.1 GT:PRODUCT putative chloramphenicol resistance transporter GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2012873..2014048) GB:FROM 2012873 GB:TO 2014048 GB:DIRECTION - GB:PRODUCT putative chloramphenicol resistance transporter GB:PROTEIN_ID BAD56687.1 LENGTH 391 SQ:AASEQ MPPTLYLLALAVFAMGTSEFMLAGLLPAIAADLGVPLGAAGMATSAFAVGMVVGAPLTAAFARRWPPRRGLPAFVLVFAVVHVAGALADHLWVLVVTRVAAAFAYAGFLAVALATAVTLVPAERTGRALAVLLSGTTLATVAGVPGGAVLGGLLGWRVTFWAVAVLCLPAAVGIATAKTLRRPDAGSRAERPAALALRAEIAQLARPRLLSAMTTAALVNAGTFGAFTFLAPLITGPVGLSQRWIPVALMLFGLGSWLGVTAAGRLADRWPGQVVAVGGPLALLGWLATAATTHPATLLVLVAVQGALSFAVGSTLVARVLGEATGAPTMGGAYATAALNLGAALGPIAAAATLGTGPAERAPFVAAAVAVALALATASATRVRAAVPVNR GT:EXON 1|1-391:0| BL:SWS:NREP 1 BL:SWS:REP 1->330|CMLR_STRLI|2e-43|55.5|326/392| TM:NTM 12 TM:REGION 10->32| TM:REGION 41->62| TM:REGION 70->92| TM:REGION 99->121| TM:REGION 128->150| TM:REGION 157->179| TM:REGION 215->237| TM:REGION 245->267| TM:REGION 270->291| TM:REGION 298->320| TM:REGION 330->352| TM:REGION 362->382| SEG 73->88|afvlvfavvhvagala| SEG 95->122|vvtrvaaafayagflavalatavtlvpa| SEG 135->155|gttlatvagvpggavlggllg| SEG 188->206|raerpaalalraeiaqlar| SEG 274->304|vvavggplallgwlataatthpatllvlvav| SEG 331->359|ggayataalnlgaalgpiaaaatlgtgpa| SEG 362->389|apfvaaavavalalatasatrvraavpv| RP:PFM:NREP 1 RP:PFM:REP 7->71|PF07690|3e-04|38.5|65/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 8->260|PF07690|3.6e-31|29.0|248/353|MFS_1| HM:PFM:REP 217->376|PF07690|2e-09|28.5|158/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| HM:SCP:REP 1->390|1pw4A_|2.9e-49|30.8|389/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 159 OP:NHOMOORG 123 OP:PATTERN -------------------------------------------------------------------- -----------1121----------2----------3211-1--1-14--------1-----1-1-2133-------------------------------1-------------------------------------------------------------------------------------------1----------1---1--------1-------------1--------------------------------------1---------------------------------------------------------------------------------------------------------2----------31---------------------------1--2--211---111-111----------------------1--1-------------------------------------------11222223----11111112121211221--111--3---11-21-1------------------2---------------------------------1-----------------------------1----------------------1-1---------------1-----------------------------------111-1---1-111111111111112---------1----------------------------2---------------------------1--1-11-1111--1------------1--1-----1-1----11111------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 181-198, 389-391| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //