[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56695.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:176 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   113->162 PF07332 * DUF1469 5.6e-05 30.6 49/121  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56695.1 GT:GENE BAD56695.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2022734..2023264 GB:FROM 2022734 GB:TO 2023264 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56695.1 LENGTH 176 SQ:AASEQ MRPVTLPTIVIGCYAVLASFAFAATLTETILFYPNVFHDVPRSLELTEEFMSAVGVGDVLRPLGAVLTLTALVAAAVATRYRVARGWLVASLASLITGQFLLSVGYQWPRVEILFDDRAAHTTAELERAASEFLVGQVLRVGAAGLTATFAVLAALACHRAYVLAAARRDLETALA GT:EXON 1|1-176:0| TM:NTM 4 TM:REGION 10->32| TM:REGION 50->72| TM:REGION 85->106| TM:REGION 134->156| SEG 65->85|avltltalvaaavatryrvar| SEG 141->157|vgaagltatfavlaala| HM:PFM:NREP 1 HM:PFM:REP 113->162|PF07332|5.6e-05|30.6|49/121|DUF1469| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //