[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56710.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  31/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:181 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   111->161 PF05154 * TM2 2e-05 46.9 %
:HMM:PFM   112->164 PF05154 * TM2 6.6e-19 52.0 50/51  
:BLT:SWISS 116->176 TM2D2_RAT 1e-06 43.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56710.1 GT:GENE BAD56710.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2035336..2035881 GB:FROM 2035336 GB:TO 2035881 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56710.1 LENGTH 181 SQ:AASEQ MTDPYQQNPGYGGPQYGPPGTGPDLSKGAGQQPYGQQSDPYAQQPQQPYGQQSDPYAQQAAYGQQPYGQQPYGQPGYGQPGGYPPAPYPQGYNPNDPEAPYGRDPFGVPFSDKQKLTAGLLQIFLGGFGVGRFYTGYTGIAIAQIAVTWLTCGIGAIWPLVDGIMMLTGKVPDAQGRPLRD GT:EXON 1|1-181:0| BL:SWS:NREP 1 BL:SWS:REP 116->176|TM2D2_RAT|1e-06|43.9|57/213| SEG 4->23|pyqqnpgyggpqygppgtgp| SEG 35->92|gqqsdpyaqqpqqpygqqsdpyaqqaaygqqpygqqpygqpgygqpggyppapypqgy| RP:PFM:NREP 1 RP:PFM:REP 111->161|PF05154|2e-05|46.9|49/53|TM2| HM:PFM:NREP 1 HM:PFM:REP 112->164|PF05154|6.6e-19|52.0|50/51|TM2| OP:NHOMO 35 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- -----------------11-11--211111121---1111-1-1--------1-------111-11-2---1---------------------------------------------------------------------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------- DISOP:02AL 1-2, 8-118, 179-181| PSIPRED ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc //