[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56713.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:136 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   44->94 PF11306 * DUF3108 9e-04 41.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56713.1 GT:GENE BAD56713.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2038373..2038783) GB:FROM 2038373 GB:TO 2038783 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56713.1 LENGTH 136 SQ:AASEQ MPKRISDVSLHVYATPEILDQVVDTVRAVVDDHLQERDVFAWRFTLPVDTDDPAHRLLETQWLLDHPGEQPDGRGTYEIALSLVGAPTDLTAAGLAALEDRLMLETSCGCFDLDVPRTITTQRRDSYDYEFEREIL GT:EXON 1|1-136:0| RP:PFM:NREP 1 RP:PFM:REP 44->94|PF11306|9e-04|41.2|51/201|DUF3108| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEccccccHHHHHHHHHHHHccccccccccccEEEEEEEEcccccHHHHHHHHHHHHHEEEccccEEEcccccccccccccccccccccccc //