[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56723.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.270.1
:144 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  51->142 1sr9A3  d.270.1.1 * 1e-06 28.6 %
:HMM:SCOP  35->142 1sr9A3 d.270.1.1 * 2.2e-17 31.5 %
:RPS:PFM   29->142 PF08502 * LeuA_dimer 7e-06 30.7 %
:HMM:PFM   31->142 PF08502 * LeuA_dimer 1.7e-11 27.7 112/133  
:BLT:SWISS 51->141 LEU1_ARTCA 3e-06 31.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56723.1 GT:GENE BAD56723.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2052022..2052456 GB:FROM 2052022 GB:TO 2052456 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56723.1 LENGTH 144 SQ:AASEQ MTFLALDPHAFVSAAPRTLRAESAGMSPAEFYDRYCQDSGPVRLSDWVAVGGRAAAYTATLEFADRLRTVATIGSPVAALTSALYEEGFPVEILQFHQRRTSEGTATFVQCEVNGKRGWGAALADDSAESSARAMISGINRLGS GT:EXON 1|1-144:0| BL:SWS:NREP 1 BL:SWS:REP 51->141|LEU1_ARTCA|3e-06|31.1|90/579| SEG 121->134|aaladdsaessara| RP:PFM:NREP 1 RP:PFM:REP 29->142|PF08502|7e-06|30.7|114/132|LeuA_dimer| HM:PFM:NREP 1 HM:PFM:REP 31->142|PF08502|1.7e-11|27.7|112/133|LeuA_dimer| GO:PFM:NREP 2 GO:PFM GO:0003852|"GO:2-isopropylmalate synthase activity"|PF08502|IPR013709| GO:PFM GO:0009098|"GO:leucine biosynthetic process"|PF08502|IPR013709| RP:SCP:NREP 1 RP:SCP:REP 51->142|1sr9A3|1e-06|28.6|91/115|d.270.1.1| HM:SCP:REP 35->142|1sr9A3|2.2e-17|31.5|108/152|d.270.1.1|1/1|2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain| OP:NHOMO 12 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- --------------1------1---2------11111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 48-49| PSIPRED cEEEEEccHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccEEEcccccEEEEEEEEEccEEEEEEccccHHHHHHHHHHHccccEEEEEEEEEcccccEEEEEEEEEccEEEEEEEEcccHHHHHHHHHHHHHHHccc //