[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56727.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  106/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->116 1s7iA PDBj 8e-10 26.7 %
:RPS:SCOP  2->110 1mwqA  d.58.4.7 * 6e-11 15.9 %
:HMM:SCOP  1->118 1s7iA_ d.58.4.9 * 2.3e-37 40.7 %
:RPS:PFM   60->114 PF03795 * YCII 4e-10 50.9 %
:HMM:PFM   1->114 PF03795 * YCII 9.5e-23 35.5 93/95  
:BLT:SWISS 1->97 Y369_RHIME 2e-07 26.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56727.1 GT:GENE BAD56727.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2055506..2055934 GB:FROM 2055506 GB:TO 2055934 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56727.1 LENGTH 142 SQ:AASEQ MKYMLIMRATDEAIEAAKQIPFEQIIEDMGKFNESLMKAGVLLGGEGLREPEEGFVVDFSADPPLVTDGPYGETKELFGGFWLLDVASKEEAVEWAKRVPLGPGSKIEVRRVTEPEDFPQDNEWVQKESAWREELGTGTGTA GT:EXON 1|1-142:0| BL:SWS:NREP 1 BL:SWS:REP 1->97|Y369_RHIME|2e-07|26.8|97/100| SEG 42->54|llggeglrepeeg| BL:PDB:NREP 1 BL:PDB:REP 1->116|1s7iA|8e-10|26.7|116/124| RP:PFM:NREP 1 RP:PFM:REP 60->114|PF03795|4e-10|50.9|55/94|YCII| HM:PFM:NREP 1 HM:PFM:REP 1->114|PF03795|9.5e-23|35.5|93/95|YCII| RP:SCP:NREP 1 RP:SCP:REP 2->110|1mwqA|6e-11|15.9|88/100|d.58.4.7| HM:SCP:REP 1->118|1s7iA_|2.3e-37|40.7|118/124|d.58.4.9|1/1|Dimeric alpha+beta barrel| OP:NHOMO 154 OP:NHOMOORG 113 OP:PATTERN -------------------------------------------------------------------- -21-2--------------------1-------1112121-1-1-2-11---1--------1--22--1-1-----------------------------------------------------------------------------------------------1--1--------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------1-1---2------11221--1-111-----------------2--12--211---------11------1-11-----------------1---------------------------------11--11--222222-222222222222-2221-11-----111-----112--1----------------1---------------------------112124----------------------------------2---------------------------------------------------------------------------------------------------------------------------------------1----------------------------11111--1-1----1---------------------------11-1-11------------------------------------------------------------------ ---------------------------11---1------------------111--------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 81.7 SQ:SECSTR EEEEEEEEEcGGGcccccHHHHHHHHHHHHHHHHHHHHHTcEEEEEEcccGGGcEEEEEccccEEEEEccccccccEEEEEEEEEEccHHHHHHHHTTcGGGGGcEEEEEEccccc########################## DISOP:02AL 14-19, 137-142| PSIPRED cEEEEEEEcccHHHHccccccHHHHHHHHHHHHHHHHHccEEEEccccccccccEEEEEEccEEEEEEccccccccEEEEEEEEEcccHHHHHHHHHHccccccccEEEEEcccHHHccccHHHHHHHHHHHHHHccccccc //