[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56729.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:173 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   49->84 PF05331 * DUF742 0.00031 32.4 34/114  
:BLT:SWISS 24->157 MEND_CHLL2 8e-04 33.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56729.1 GT:GENE BAD56729.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2057260..2057781) GB:FROM 2057260 GB:TO 2057781 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56729.1 LENGTH 173 SQ:AASEQ MSEASAEVLLDDFENKDNWELAGPGAERTHLTTFAEGAPWKRPGVYADGAAGADHRAVVLLIRSATEGFAVELAARADRPITVAGPMTALCLWVRSPHASLTVGARLRHGGADTEVDLGRVTAAGEWTRLEFRPAEPLADVELRAVTIRLDEVVKRAGEVMILFDDLTAATGA GT:EXON 1|1-173:0| BL:SWS:NREP 1 BL:SWS:REP 24->157|MEND_CHLL2|8e-04|33.9|121/100| HM:PFM:NREP 1 HM:PFM:REP 49->84|PF05331|0.00031|32.4|34/114|DUF742| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 172-173| PSIPRED cccccHHHHEEccccccccEEEcccccccEEEEEccccccccccEEEcccccccccEEEEEEEcccccEEEEEEEcccccEEEEccHHEEEEEEcccccEEEEEEEEEccccccEEEccEEEEcccEEEEEEEccccccccEEEEEEEEHHHHHHHcccEEEEEEcccccccc //