[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56731.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.122.1
:329 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  210->327 1l0oA_ d.122.1.3 * 1.8e-06 25.6 %
:HMM:PFM   239->328 PF02518 * HATPase_c 3.4e-05 27.8 90/111  
:BLT:SWISS 153->232 MIAA_RHOP2 2e-04 38.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56731.1 GT:GENE BAD56731.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2059513..2060502) GB:FROM 2059513 GB:TO 2060502 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56731.1 LENGTH 329 SQ:AASEQ MVIGSERGGDDARSEPVPPHDDRAHDDPFHHPAFFYRDSEEYLAGTLAFIGAGLSRGEPVAVSVPGPNLALIRAALGADAADVRLMDMTVEGRNPGRIIPGVLRAFADEHPEGRVRIIGEPIWASRSATEYPACAQHEALINAAFTGREVSILCPYDVSRLAPAVVEDALATHPVVLDGHGERVSPAYDPDRIVATYNQPLPDPPPTAFLREFDAAALTPVRHQAVDYVRALGMSTARVTDLELVVGETTTNSVVHGGGSGTLALWVQSGQLVCQVSDGGTITDPLAGRRPAPPLRPGGRGLLLVNHLADLVRLHTAPSGTTLRMYFDL GT:EXON 1|1-329:0| BL:SWS:NREP 1 BL:SWS:REP 153->232|MIAA_RHOP2|2e-04|38.7|75/100| SEG 69->85|laliraalgadaadvrl| SEG 285->304|plagrrpapplrpggrglll| HM:PFM:NREP 1 HM:PFM:REP 239->328|PF02518|3.4e-05|27.8|90/111|HATPase_c| HM:SCP:REP 210->327|1l0oA_|1.8e-06|25.6|117/141|d.122.1.3|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ----1----------11-------1------1----1----111----------------11---1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-20, 289-295| PSIPRED ccccccccccccccccccccccccccccccEEEEEEccHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHccccccccEEEEcHHHccHHHHHHHHHHHHHHHcccccEEEEEccccccccccccHHHHHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHHcccccHHHHHHHcccccccHHHHcccccccccccccHHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHEEEEccccEEEEEEEEccEEEEEEEcccccccccccccccccccccccHHHHHHHHHHHcccEEccccEEEEEEEcc //