[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56732.1
DDBJ      :             putative sigma factor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  903/915 : Eukaryota  21/199 : Viruses  0/175   --->[See Alignment]
a.177.1a.4.13b.52.2
:273 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->262 3dxjF PDBj 1e-15 27.1 %
:RPS:PDB   43->264 3dxjF PDBj 3e-26 23.6 %
:RPS:SCOP  43->157 1aw8.1  b.52.2.1 * 3e-22 11.6 %
:RPS:SCOP  211->263 1ku3A  a.4.13.2 * 5e-10 28.3 %
:HMM:SCOP  15->116 1iw7F3 a.177.1.1 * 1.1e-26 31.4 %
:HMM:SCOP  119->198 1rp3A1 a.4.13.1 * 4.2e-12 35.1 %
:HMM:SCOP  176->265 1iw7F2 a.4.13.2 * 2.8e-14 31.1 %
:RPS:PFM   46->94 PF04542 * Sigma70_r2 6e-08 46.9 %
:RPS:PFM   215->262 PF04545 * Sigma70_r4 8e-04 47.9 %
:HMM:PFM   47->115 PF04542 * Sigma70_r2 2.8e-19 36.2 69/71  
:HMM:PFM   215->263 PF04545 * Sigma70_r4 1.2e-18 49.0 49/50  
:HMM:PFM   132->187 PF04539 * Sigma70_r3 2.7e-11 35.7 56/78  
:BLT:SWISS 26->262 RPOF_STRCO 3e-41 38.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56732.1 GT:GENE BAD56732.1 GT:PRODUCT putative sigma factor GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2060697..2061518 GB:FROM 2060697 GB:TO 2061518 GB:DIRECTION + GB:PRODUCT putative sigma factor GB:PROTEIN_ID BAD56732.1 LENGTH 273 SQ:AASEQ MSNSMQARNEPSPSEGDGYENIEPWFEKLAALDADDPHRAVVREEILHRCLPLAHNIARRFTNRGVEFEDLLQIARLGLVHAVDRFDLEHGDSFLGFAVPTIMGEVRRYFRDHGWAVRVPRRMKELHQLLGPATDRLTHQLGRQPTARELASELGVELTEVTQALVARNAFTTESLDGGERTGEEGGALPIADRLGAVEPCYGLLEDAMAVRPLIAALPERERQVLILRFYDNKTQAEIGRLLGCSQMQVSRILAKTLTMLREKALAEPVPAS GT:EXON 1|1-273:0| BL:SWS:NREP 1 BL:SWS:REP 26->262|RPOF_STRCO|3e-41|38.9|234/287| BL:PDB:NREP 1 BL:PDB:REP 4->262|3dxjF|1e-15|27.1|258/349| RP:PDB:NREP 1 RP:PDB:REP 43->264|3dxjF|3e-26|23.6|220/349| RP:PFM:NREP 2 RP:PFM:REP 46->94|PF04542|6e-08|46.9|49/70|Sigma70_r2| RP:PFM:REP 215->262|PF04545|8e-04|47.9|48/49|Sigma70_r4| HM:PFM:NREP 3 HM:PFM:REP 47->115|PF04542|2.8e-19|36.2|69/71|Sigma70_r2| HM:PFM:REP 215->263|PF04545|1.2e-18|49.0|49/50|Sigma70_r4| HM:PFM:REP 132->187|PF04539|2.7e-11|35.7|56/78|Sigma70_r3| GO:PFM:NREP 10 GO:PFM GO:0003677|"GO:DNA binding"|PF04542|IPR007627| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04542|IPR007627| GO:PFM GO:0006352|"GO:transcription initiation"|PF04542|IPR007627| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04542|IPR007627| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04542|IPR007627| GO:PFM GO:0003677|"GO:DNA binding"|PF04545|IPR007630| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04545|IPR007630| GO:PFM GO:0006352|"GO:transcription initiation"|PF04545|IPR007630| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04545|IPR007630| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04545|IPR007630| RP:SCP:NREP 2 RP:SCP:REP 43->157|1aw8.1|3e-22|11.6|112/115|b.52.2.1| RP:SCP:REP 211->263|1ku3A|5e-10|28.3|53/61|a.4.13.2| HM:SCP:REP 15->116|1iw7F3|1.1e-26|31.4|102/184|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| HM:SCP:REP 119->198|1rp3A1|4.2e-12|35.1|77/0|a.4.13.1|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| HM:SCP:REP 176->265|1iw7F2|2.8e-14|31.1|90/105|a.4.13.2|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 2198 OP:NHOMOORG 924 OP:PATTERN -------------------------------------------------------------------- 2244722222222234433-36223333333345557465433451123332232111114471855DDC61111111211271124311111111-11-11112111121111111222222211-1111111114555611155K7A75525688576696554799B756555556555532-1122133544444444344444455445544445544332222227422222222222222222222111211211111111111111111111111111111111111111111111111111111111111111155544444444444355443333535324444444545445334455211325111111111111111121111111111111111-11112111111111111111111111111212222211111111111111111111111111111111111111111111111111211211112444464233433323333424444454411333242222113224324122321111111223232221122122122221334333333111123131111111111111112212221111333423433333244333434333433434431-1433311111132333333332333333-333342323333423322322233333233333333333333333132133223434443434431121222223333113331111111111111111111111111333333333343333333311111111123443333334333311111111111111112422222211111111221111-1-11111111111111--1112131112111241 -------1----------------------------------------------------------------------------------------------------1-------------------------------------------------1----------------3111B111-14245-31-21---3 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 265 STR:RPRED 97.1 SQ:SECSTR ###cTTcccccccccccTTHccccccccccccccccHHHHHEHHHHHHHTHHHHHHHHGGGccccccHHHHHHHHHHHHHHHHHcccTTccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcTTccHHHHHHHHHHTcccccTTcccTTcccccGGGccccccccccHHHHHHHHHHHHcccHHHHHHHHHHTTTTccTTcHHHHHHHTTcccHHHHHHHHHHHHHHHHHHcccc##### DISOP:02AL 1-24, 265-273| PSIPRED ccHHHHHHHHcccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccc //