[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56741.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.43.1
:52 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->47 1bdtC PDBj 8e-05 23.4 %
:HMM:SCOP  1->50 1mntA_ a.43.1.1 * 7.4e-09 36.0 %
:HMM:PFM   4->38 PF05534 * HicB 2.1e-08 37.1 35/51  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56741.1 GT:GENE BAD56741.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2069783..2069941 GB:FROM 2069783 GB:TO 2069941 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56741.1 LENGTH 52 SQ:AASEQ MPERKKLLLRLDPAVHEAIARWAADDLRSINAQIEYALRLALEQAGRKPKAD GT:EXON 1|1-52:0| RP:PDB:NREP 1 RP:PDB:REP 1->47|1bdtC|8e-05|23.4|47/50| HM:PFM:NREP 1 HM:PFM:REP 4->38|PF05534|2.1e-08|37.1|35/51|HicB| HM:SCP:REP 1->50|1mntA_|7.4e-09|36.0|50/0|a.43.1.1|1/1|Ribbon-helix-helix| OP:NHOMO 25 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ----2----11-------------------------1------1--------------------1-1--11-------1-1-----------------------------------------------------------------1-----------------------------------------------------------------------1-------------1-----------------------------------------------------------------------------------------------------------------------------1-----1--------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 48 STR:RPRED 92.3 SQ:SECSTR TTTcccccccccHHHHHHHHHHHHTTTccHHHHHHHHHHHHHHTTccc#### DISOP:02AL 1-4, 49-52| PSIPRED cccccccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //