Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56744.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:112 amino acids
:HMM:PFM   45->71 PF04576 * DUF593 0.00021 37.0 27/94  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56744.1 GT:GENE BAD56744.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2072740..2073078 GB:FROM 2072740 GB:TO 2073078 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56744.1 LENGTH 112 SQ:AASEQ MRKTPVRVDRGLVVTWVERCRREWHQLAAAGTQRDVAMAGRRRIAEKLCRAGLTNEVNHERRCSASAAATAGISRQCTRPGVPRRWRPAWLLLMPNGVPLLAGIGLDRHGED GT:EXON 1|1-112:0| HM:PFM:NREP 1 HM:PFM:REP 45->71|PF04576|0.00021|37.0|27/94|DUF593| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 108-112| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccHHHHHcHHHHHHHcccccccccccccccccEEEEEccccccEEEEccccccccc //