[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56749.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  128/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:156 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   19->136 3bt3A PDBj 3e-15 12.8 %
:RPS:SCOP  11->132 1xy7A  d.32.1.9 * 2e-22 23.7 %
:HMM:SCOP  10->135 1u7iA_ d.32.1.7 * 4.1e-27 29.5 %
:RPS:PFM   13->128 PF00903 * Glyoxalase 5e-08 32.5 %
:HMM:PFM   17->130 PF00903 * Glyoxalase 3.7e-16 25.4 114/128  
:BLT:SWISS 19->143 Y911_MYCBO 1e-15 39.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56749.1 GT:GENE BAD56749.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2078086..2078556) GB:FROM 2078086 GB:TO 2078556 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56749.1 LENGTH 156 SQ:AASEQ MTAKVNPIPDGYHSITCFLAVDDGVKAIDFYRAVFGAEVLSRNDLPDGQPAHAELRIGDSTIQVGLPVPEHGVRAPNGEWVHTSIVHYCPDVDAVVRRAAEHGARSVDEPQTFLTGDRFAAVLDPFGHRWVVMTRVEDVSREEGERRVQEWLATQS GT:EXON 1|1-156:0| BL:SWS:NREP 1 BL:SWS:REP 19->143|Y911_MYCBO|1e-15|39.2|125/170| RP:PDB:NREP 1 RP:PDB:REP 19->136|3bt3A|3e-15|12.8|117/129| RP:PFM:NREP 1 RP:PFM:REP 13->128|PF00903|5e-08|32.5|114/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 17->130|PF00903|3.7e-16|25.4|114/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 11->132|1xy7A|2e-22|23.7|114/120|d.32.1.9| HM:SCP:REP 10->135|1u7iA_|4.1e-27|29.5|122/134|d.32.1.7|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 174 OP:NHOMOORG 130 OP:PATTERN --------------------------------------------1----------------------- 113--------1--11111-13--1211111123332111-1--12-1----1----------------------------------------------------1-1-----------------------------11-----1-1-------------------111----------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------1112------2---1-----------------------------1-1---11111-11-1--1----1--11---------------1-------------------------------------11-12222221111-22122222123211111--222--------1--111-----------------1----------------1-1-1-2--222213--------------------------------------1-----------------------------------------------------------------------------------------------------------------------111111----1-1---------------------------------111--1111---------------------------------------------------------------------------------------------------1- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 140 STR:RPRED 89.7 SQ:SECSTR ################EEEEEccHHHHHHHHHHTTccEEEEEEEcTTccEEEEEEEcccTTTTcccccccEEEEEccccccEEHEEEEcccHHHHHHHHHHTTcccccccEEETTTEEEEEEEcTTccEEEEEEEccEEEEEEETTEcccEEcccc DISOP:02AL 1-5| PSIPRED cccccccccccccEEEEEEEEccHHHHHHHHHHHcccEEEEEEccccccEEEEEEEEccEEEEEEccccccccccccccccEEEEEEEEccHHHHHHHHHHcccEEEEcccccccccEEEEEEccccEEEEEEEccccccHHHHHHHHHHHHHccc //