[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56751.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:150 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->148 1tq8E PDBj 4e-21 48.7 %
:RPS:PDB   4->147 2dumC PDBj 3e-08 19.9 %
:RPS:SCOP  4->146 1mjhA  c.26.2.4 * 4e-08 18.4 %
:HMM:SCOP  4->147 2gm3A1 c.26.2.4 * 1.4e-26 30.1 %
:HMM:PFM   4->147 PF00582 * Usp 9.9e-30 30.9 139/140  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56751.1 GT:GENE BAD56751.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2079957..2080409 GB:FROM 2079957 GB:TO 2080409 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56751.1 LENGTH 150 SQ:AASEQ MTAYRTIVVGTDGSDSSYVAVEKAAALAADADATLVVACAYYPTDDREIAAAADVLKDEAYQVRGSAPTTEILRIARDKAVASGAKNIIERPVVGEPVESLLNLVKETEADLLVVGNRGLNTLTGRLLGSVPSDVARKSRSDVLIVHTVR GT:EXON 1|1-150:0| SEG 19->40|vavekaaalaadadatlvvaca| SEG 116->129|gnrglntltgrllg| BL:PDB:NREP 1 BL:PDB:REP 1->148|1tq8E|4e-21|48.7|119/125| RP:PDB:NREP 1 RP:PDB:REP 4->147|2dumC|3e-08|19.9|136/146| HM:PFM:NREP 1 HM:PFM:REP 4->147|PF00582|9.9e-30|30.9|139/140|Usp| RP:SCP:NREP 1 RP:SCP:REP 4->146|1mjhA|4e-08|18.4|136/143|c.26.2.4| HM:SCP:REP 4->147|2gm3A1|1.4e-26|30.1|143/0|c.26.2.4|1/1|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 37 OP:NHOMOORG 36 OP:PATTERN -------------------------------------------------------------------- -----11111111111111-11111211111111111111-------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 148 STR:RPRED 98.7 SQ:SECSTR cccccEEEEEccccHHHHHHHHHHHHHccccccEEEEEEEEEGGGTTccccccGGGTHHHHHHHHHHHHHHHHHHHHHHHHHTTccEEEEEEEEEcHHHHHHHHHHHHTccEEEEEccccccccTTcccHHHHHHHHHccccEEEEcc## PSIPRED cccccEEEEEccccHHHHHHHHHHHHHHHHcccEEEEEEEEEcccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccHHHHHHHHHHHHcccEEEEEccccccHHHHcccHHHHHHHHHccccEEEEcccc //