[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56758.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:113 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   26->62 PF08899 * DUF1844 0.00026 32.4 37/74  
:BLT:SWISS 8->77 LEXA2_NOCFA 3e-04 40.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56758.1 GT:GENE BAD56758.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2091026..2091367) GB:FROM 2091026 GB:TO 2091367 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56758.1 LENGTH 113 SQ:AASEQ MTDELDDSVRELADIPAVEVISRAAVMLMSSAAEKLGLADEDPDNSPRKDLDEARRVITALAGLVTASVEYLGPHAGPIRDGLQSLQRAFREASAHPDEPGKGPGEKYTGPVY GT:EXON 1|1-113:0| BL:SWS:NREP 1 BL:SWS:REP 8->77|LEXA2_NOCFA|3e-04|40.3|67/243| HM:PFM:NREP 1 HM:PFM:REP 26->62|PF08899|0.00026|32.4|37/74|DUF1844| OP:NHOMO 30 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- ----1---------1------1---1------11111111----111-111-111111------111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 97-108, 111-113| PSIPRED ccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccccccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc //