[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56766.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:95 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->78 3gz7B PDBj 2e-04 37.3 %
:RPS:PDB   1->89 2bbeA PDBj 5e-10 14.6 %
:RPS:SCOP  1->91 1iujA  d.58.4.5 * 2e-11 12.1 %
:HMM:SCOP  1->89 1iujA_ d.58.4.5 * 2e-11 30.3 %
:HMM:PFM   1->68 PF03992 * ABM 7.3e-11 23.5 68/78  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56766.1 GT:GENE BAD56766.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2098255..2098542) GB:FROM 2098255 GB:TO 2098542 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56766.1 LENGTH 95 SQ:AASEQ MIVVAGHLVVDPAQRADYLAGCAEVVAQARAARGCLDFAIGPDLVDPARINVYERWATAADVAAFRGSGPGGEQRAAIRAASVSEYDVSAERSLT GT:EXON 1|1-95:0| BL:PDB:NREP 1 BL:PDB:REP 8->78|3gz7B|2e-04|37.3|67/95| RP:PDB:NREP 1 RP:PDB:REP 1->89|2bbeA|5e-10|14.6|89/103| HM:PFM:NREP 1 HM:PFM:REP 1->68|PF03992|7.3e-11|23.5|68/78|ABM| RP:SCP:NREP 1 RP:SCP:REP 1->91|1iujA|2e-11|12.1|91/102|d.58.4.5| HM:SCP:REP 1->89|1iujA_|2e-11|30.3|89/0|d.58.4.5|1/1|Dimeric alpha+beta barrel| OP:NHOMO 8 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-11----2---------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 89 STR:RPRED 93.7 SQ:SECSTR cEEEEEEEEEcTTcHHHHHHHHHTTHHHHHTcTTEEEEEEEEccccTTEEEEEEEEccHHHHHHHHTcHHHHHHHHHTHHHHEEEEEEE###### DISOP:02AL 94-95| PSIPRED cEEEcccEEEccHHHHHHHHHHHHHHHHHHHHccHHHcccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHccccccccccccccc //