[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56767.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:121 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   19->78 3deuB PDBj 2e-04 25.4 %
:RPS:SCOP  20->107 1z7uA1  a.4.5.69 * 6e-12 19.3 %
:HMM:SCOP  12->107 2f2eA1 a.4.5.69 * 2.3e-20 36.8 %
:RPS:PFM   28->75 PF01638 * HxlR 2e-04 33.3 %
:HMM:PFM   27->109 PF01638 * HxlR 6.1e-18 31.3 83/91  
:BLT:SWISS 24->75 YVAP_BACSU 1e-05 32.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56767.1 GT:GENE BAD56767.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2098648..2099013) GB:FROM 2098648 GB:TO 2099013 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD56767.1 LENGTH 121 SQ:AASEQ MRSANREPGAGRAPDPAHDSVLAAMDLLGQRWMVRVVWELEPGPLGFLQLRRRMGNCSSSMLSNRLQQLQAAGLIVKHGPKGAYELTATGVALGAALRPLWEWAAAWTPDDGVDAGEPDRR GT:EXON 1|1-121:0| BL:SWS:NREP 1 BL:SWS:REP 24->75|YVAP_BACSU|1e-05|32.7|52/108| SEG 86->97|ltatgvalgaal| RP:PDB:NREP 1 RP:PDB:REP 19->78|3deuB|2e-04|25.4|59/130| RP:PFM:NREP 1 RP:PFM:REP 28->75|PF01638|2e-04|33.3|48/91|HxlR| HM:PFM:NREP 1 HM:PFM:REP 27->109|PF01638|6.1e-18|31.3|83/91|HxlR| RP:SCP:NREP 1 RP:SCP:REP 20->107|1z7uA1|6e-12|19.3|88/108|a.4.5.69| HM:SCP:REP 12->107|2f2eA1|2.3e-20|36.8|95/0|a.4.5.69|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ----1---------1---------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------1---------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 62 STR:RPRED 51.2 SQ:SECSTR ################GGHHHTGGGTccHHHHHHHHHHHTccccccHHHHHHHHTTccHHHHHHHHHHHHHTTcEEcc########################################### DISOP:02AL 1-10, 115-121| PSIPRED ccccccccccccccccccccHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHHcccEEcccccEEEEEcHHHHHHHHHHHHHHHHHHHHcccccccccccccc //