[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56771.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  94/915 : Eukaryota  38/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   8->87 3djmD PDBj 1e-07 37.2 %
:RPS:PDB   2->95 3djmA PDBj 1e-27 32.6 %
:RPS:PFM   25->91 PF04248 * DUF427 5e-13 53.7 %
:HMM:PFM   3->90 PF04248 * DUF427 2.6e-35 46.6 88/95  
:PROS 1->24|PS00430|TONB_DEPENDENT_REC_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56771.1 GT:GENE BAD56771.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2101710..2102000 GB:FROM 2101710 GB:TO 2102000 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56771.1 LENGTH 96 SQ:AASEQ MTVRAEWNGTVLAESDDTVVVEGNHYFPVSAIRTEYFAPSDTHTVCPWKGTASYYTVRVDGSENPDAAWYYPAPKDAAAQIKDRVAFWRGVDVIED GT:EXON 1|1-96:0| PROS 1->24|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| BL:PDB:NREP 1 BL:PDB:REP 8->87|3djmD|1e-07|37.2|78/109| RP:PDB:NREP 1 RP:PDB:REP 2->95|3djmA|1e-27|32.6|92/110| RP:PFM:NREP 1 RP:PFM:REP 25->91|PF04248|5e-13|53.7|67/95|DUF427| HM:PFM:NREP 1 HM:PFM:REP 3->90|PF04248|2.6e-35|46.6|88/95|DUF427| OP:NHOMO 165 OP:NHOMOORG 135 OP:PATTERN -------------------------------------------------1----------------11 1---1---------1--22-21--2122222121-11122-2-1-----11------1--1-2-1-1111---------------------------------1-1--1---------------------------11111-----211211222--11111-1221221--------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1--1----------------------1--1-1111-----1----1-1-----12-----1---------------------------------------------------1------------1-------1--------------1---111---11-2---------------------------------------------------------------------------------------------------------------1---1-----------------------------------------------------------------------------------------------------------1-----------------------------------1----------------------------------------------------------------------------------------------------------- --------------11-22-11111--111111----------1111112--1-121--------------------------------1-1--1111111--------------------------------------------------------------1---------------------1---2--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 94 STR:RPRED 97.9 SQ:SECSTR #cEEEEccccEEEEEcccEEEETTcEccGGGccGcGEEEEEEEEEETTTEEEEEEEEEETTEEEEEEEEEEccccTTcGGGTTccEETTTcEEEE# PSIPRED cEEEEEEccEEEEEccccEEEcccccccHHHHcHHHEEccccEEEcccccEEEEEEEEEccEEEEEEEEEccccHHHHHHHccEEEEccccEEEEc //