[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56778.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  106/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:322 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   17->61 2acjA PDBj 9e-06 18.2 %
:RPS:PDB   149->300 3btaA PDBj 5e-16 6.8 %
:RPS:SCOP  16->62 1o57A1  a.4.5.40 * 5e-08 17.0 %
:HMM:SCOP  1->61 1biaA1 a.4.5.1 * 1.2e-11 44.3 %
:RPS:PFM   14->56 PF08279 * HTH_11 2e-05 55.8 %
:HMM:PFM   5->56 PF08279 * HTH_11 4.5e-20 59.6 52/55  
:BLT:SWISS 15->211 YOBV_BACSU 9e-15 29.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56778.1 GT:GENE BAD56778.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2109836..2110804) GB:FROM 2109836 GB:TO 2110804 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD56778.1 LENGTH 322 SQ:AASEQ MRASRLLRLLLLLQTRGRVSAPELAAELEVSVRTVYRDVEALSAAGVPVYSEPGRGGGVRLLDGFRTRLTGLTSAEADAVLLAGLPAAAADLGLGAVLATAQLKMLAALPPELRGRATRIAERVHVDAPGWFHRPDETPTLATVADALWHDRRLDVRYGRPDREVRRLLDPLGLVLKAGTWYLVARHEHDIRSYRVGRIRAAEPTGETFTRPAGFELADHWSTAQDEFARSMLRVRARCRIAADHLGLLRLGFDPAAVTEAFASRGEPDADGWVEVTVAAESETVLVHGILPLAEYAEILDPPELRARLAATTRAMAARYAG GT:EXON 1|1-322:0| BL:SWS:NREP 1 BL:SWS:REP 15->211|YOBV_BACSU|9e-15|29.0|193/313| SEG 5->13|rllrlllll| SEG 77->99|adavllaglpaaaadlglgavla| SEG 274->287|vevtvaaesetvlv| SEG 305->321|lrarlaattramaarya| RP:PDB:NREP 2 RP:PDB:REP 17->61|2acjA|9e-06|18.2|44/53| RP:PDB:REP 149->300|3btaA|5e-16|6.8|132/1277| RP:PFM:NREP 1 RP:PFM:REP 14->56|PF08279|2e-05|55.8|43/52|HTH_11| HM:PFM:NREP 1 HM:PFM:REP 5->56|PF08279|4.5e-20|59.6|52/55|HTH_11| RP:SCP:NREP 1 RP:SCP:REP 16->62|1o57A1|5e-08|17.0|47/73|a.4.5.40| HM:SCP:REP 1->61|1biaA1|1.2e-11|44.3|61/0|a.4.5.1|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 145 OP:NHOMOORG 106 OP:PATTERN -------------------------------------------------------------------- -1--2---------------------------1---2133-31212----1----------1--311223----------1---------------1----1----111-----------------------------------1----------------------------------------1--------------11-11---11222--11----1---1-----43-------1--------------------------------------------1111------------------------1----------11112222122131-111----2----1----22-------------11------------1-111---1----111-11111-1-----------1-------------------2-----------------------------------------------------------------------------11------1-----1--11--------1---------------------------------------------------1-21------------------------------1-----1------------------------------------------------------------------------11-----------------------------------------------------------2-2------------------------------------------------------------------------------------------11------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 182 STR:RPRED 56.5 SQ:SECSTR #############cTTHcccHHHHHHHccccHHHHHHHHHHHHHTTc#EEEEcccccEEEEccc####################################################################################c###cccTTcccccccEEEEEcccccc###ccc####EEEEEEE#TTEEEEEEEcccccGGGcccc#ccccccccccccccTTTTccHHH#HHHHHHHHHHHHHTcHHHHHHHHHHHHccccTTc######ccccGGGEEEET#ccEEEEEc###################### PSIPRED ccHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccEEEEcccccccHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHccEEEcccccccccccHHHHHHHHHHHHcccEEEEEEEcccccEEEEEEEEEEEEEccEEEEEEEEcccEEEEEEEEEEEEEEccccccccccccHHHHHHHHHHHHcccccEEEEEEEEcHHHHHHcccccccEEEEEccccccEEccccEEEEEEEEccHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHHHHHHcc //