[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56779.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.45.1
:163 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   24->134 3dmbB PDBj 4e-10 13.3 %
:RPS:SCOP  12->114 1rfeA  b.45.1.1 * 7e-10 16.5 %
:HMM:SCOP  20->152 2hq7A1 b.45.1.1 * 5.2e-18 20.8 %
:HMM:PFM   25->101 PF01243 * Pyridox_oxidase 2e-10 24.0 75/89  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56779.1 GT:GENE BAD56779.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2110868..2111359 GB:FROM 2110868 GB:TO 2111359 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56779.1 LENGTH 163 SQ:AASEQ MTTWSRFTEEAPKIASVFTRRHRATGNLCLLGTVRADGSPRISPVEPRIFDGMLVIVGMPGTTKFKDLARDPRFCLHTATADPQVREGDAKLFGQVRDLPDREVHARFAQDLFDESGFDIRGEEFDHFYVADLTGASCVEVGADELAITIWKPGEGERVVRKS GT:EXON 1|1-163:0| RP:PDB:NREP 1 RP:PDB:REP 24->134|3dmbB|4e-10|13.3|105/141| HM:PFM:NREP 1 HM:PFM:REP 25->101|PF01243|2e-10|24.0|75/89|Pyridox_oxidase| RP:SCP:NREP 1 RP:SCP:REP 12->114|1rfeA|7e-10|16.5|103/160|b.45.1.1| HM:SCP:REP 20->152|2hq7A1|5.2e-18|20.8|130/0|b.45.1.1|1/1|FMN-binding split barrel| OP:NHOMO 17 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ----1---------1---------------------1122-211----------------------11111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 135 STR:RPRED 82.8 SQ:SECSTR HHHHHHHHHHHHHHHHHHHHccEHHHcEEEEETTcGGGccEEEccccccccccEEEEEETTcHHHHHHTTcEEEEEEcTTccEEEEccEEEEEEEEEEcccHHHHHHHccHHHHHTcccGGGcTTEEEEEEEEEc############################ DISOP:02AL 161-163| PSIPRED cccHHHHHHHccHHHHHHHHHHcccccEEEEEEEcccccccccccEEEEEccEEEEEEccccHHHHHHHccccEEEEcccccccccccEEEEEEEEEEcccHHHHHHHHHHcccccccccccccccEEEEEEcccEEEEEEcccEEEEEEEEcccccEEEEcc //