[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56780.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  58/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
d.2.1
:111 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   37->109 1xsfA PDBj 9e-25 65.8 %
:RPS:PDB   39->110 1b9oA PDBj 4e-10 20.8 %
:RPS:SCOP  38->110 1xsfA1  d.2.1.8 * 6e-11 63.0 %
:RPS:PFM   39->107 PF06737 * Transglycosylas 1e-19 78.3 %
:HMM:PFM   37->108 PF06737 * Transglycosylas 8.5e-35 70.8 72/77  
:HMM:PFM   2->57 PF10379 * nec1 0.0003 41.5 53/184  
:BLT:SWISS 43->106 SCED_STAES 4e-05 42.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56780.1 GT:GENE BAD56780.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2111423..2111758) GB:FROM 2111423 GB:TO 2111758 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56780.1 LENGTH 111 SQ:AASEQ MSQNRKLSTRAAGIVAAIGAFVAVPFAVSSATASAYGHDWDAVAQCESGGNWGINTGNGYYGGLQFSHSTWVANGGSGYAHNASREEQIRVAENVLATQGPGAWPTCGAYL GT:EXON 1|1-111:0| BL:SWS:NREP 1 BL:SWS:REP 43->106|SCED_STAES|4e-05|42.2|64/219| TM:NTM 1 TM:REGION 11->32| SEG 11->35|aagivaaigafvavpfavssatasa| BL:PDB:NREP 1 BL:PDB:REP 37->109|1xsfA|9e-25|65.8|73/108| RP:PDB:NREP 1 RP:PDB:REP 39->110|1b9oA|4e-10|20.8|72/123| RP:PFM:NREP 1 RP:PFM:REP 39->107|PF06737|1e-19|78.3|69/77|Transglycosylas| HM:PFM:NREP 2 HM:PFM:REP 37->108|PF06737|8.5e-35|70.8|72/77|Transglycosylas| HM:PFM:REP 2->57|PF10379|0.0003|41.5|53/184|nec1| GO:PFM:NREP 1 GO:PFM GO:0005576|"GO:extracellular region"|PF06737|IPR010618| RP:SCP:NREP 1 RP:SCP:REP 38->110|1xsfA1|6e-11|63.0|73/86|d.2.1.8| OP:NHOMO 192 OP:NHOMOORG 59 OP:PATTERN -------------------------------------------------------------------- ---1123222132344455-44334455555456764776112121321---121-12----1-324654-------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------- STR:NPRED 75 STR:RPRED 67.6 SQ:SECSTR ####################################HHHHHHHHHHHHTTcEEEccccEEETTTTEETTTTcccTTcTTcccTTcHHHHHHHHHHHHHTTTHHHHTTccTc DISOP:02AL 1-9| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHccccccccccccccccEEEEcHHHHHHcccccccccccHHHHHHHHHHHHHHccccccccccccc //